Claim Missing Document
Check
Articles

Found 7 Documents
Search

Revealing Potency of Bioactive Compounds as Inhibitor of Dengue Virus (DENV) NS2B/NS3 Protease from Sweet Potato (Ipomoea batatas L.) Leaves Viol Dhea Kharisma1,2, Rasyadan Taufiq Probojati1 , Ahmad Affan Ali Murtadlo1 , Arif Nur Muhammad An
Indian Journal of Forensic Medicine & Toxicology Vol. 15 No. 1 (2021): Indian Journal of Forensic Medicine & Toxicology
Publisher : Institute of Medico-legal Publications Pvt Ltd

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.37506/ijfmt.v15i1.13644

Abstract

his study aims to identify the potency of bioactive compounds of sweet potato leaf as inhibitory agentto dengue virus (DENV) NS2B/NS3 protease by using computational study. The 3D structure of NS2B/NS3 protease was collected from PDB and the 2D structure of several bioactive compounds of sweetpotato leaf were obtained from PubChem. The visualization and data analysis were performed by usingthe PyMol software. According to the in silico analysis, result demonstrated that dehydroabietinol had thelowest free energy binding. However, based on the protein-ligand analysis, all the compounds showed thehydrogen bond and hydrophobic interaction. All the compounds with hydrogen bond could not be interactedwith catalytic domain, but hydrophobic interaction could be interacted to the target domain via Ser135 by?-Selinene and His51 by ?-Caryophyllene. In summary, we conclude that ?-Selinene and ?-Caryophyllenemight have potencies as a therapeutically drug for dengue.
Application of CRISPR-Cas9 genome editing technology in various fields: A review Ansori, Arif NM.; Antonius, Yulanda; Susilo, Raden JK.; Hayaza, Suhaila; Kharisma, Viol D.; Parikesit, Arli A.; Zainul, Rahadian; Jakhmola, Vikash; Saklani, Taru; Rebezov, Maksim; Ullah, Md. Emdad; Maksimiuk, Nikolai; Derkho, Marina; Burkov, Pavel
Narra J Vol. 3 No. 2 (2023): August 2023
Publisher : Narra Sains Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.52225/narra.v3i2.184

Abstract

CRISPR-Cas9 has emerged as a revolutionary tool that enables precise and efficient modifications of the genetic material. This review provides a comprehensive overview of CRISPR-Cas9 technology and its applications in genome editing. We begin by describing the fundamental principles of CRISPR-Cas9 technology, explaining how the system utilizes a single guide RNA (sgRNA) to direct the Cas9 nuclease to specific DNA sequences in the genome, resulting in targeted double-stranded breaks. In this review, we provide in-depth explorations of CRISPR-Cas9 technology and its applications in agriculture, medicine, environmental sciences, fisheries, nanotechnology, bioinformatics, and biotechnology. We also highlight its potential, ongoing research, and the ethical considerations and controversies surrounding its use. This review might contribute to the understanding of CRISPR-Cas9 technology and its implications in various fields, paving the way for future developments and responsible applications of this transformative technology.
Identification of Potential Ebola Virus Nucleoprotein (EBOV NP) Inhibitor Derivate from Various Traditional Medicinal Plants in Indonesia: in silico study Antonius, Yulanda; Ongko, Jeremi; Sukweenadhi, Johan; Putra, Sulistyo Emantoko Dwi
MPI (Media Pharmaceutica Indonesiana) Vol. 3 No. 4 (2021): DECEMBER
Publisher : Fakultas Farmasi, Universitas Surabaya

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.24123/mpi.v3i4.4716

Abstract

Ebola virus disease is caused by Ebolavirus infection. Within infection, Ebola nucleoprotein (EBOV NP) is essential part for virus proliferation. Recent report showed that the outbreak was happened in Congo on February 2021. Although million cases were reported, the drug is remain unavailable. However, Indonesia had a high diversity of plants as traditional drugs. This research aimed to identify the traditional drug plants as potential inhibitor for EBOV NP. The SMILE notation of 65 identified compounds were collected from PubChem and 3D structured of EBOV NP (PDB ID: 4Z9P) was obtained from PDB. Molecular docking was conducted between selected compounds and EBOV NP. Clabistrin C was selected as a control. Complex of compounds EBOV NP and its amino acid residues were depicted by using Chimera X and LigPlot. Several potential compounds were selected for pharmacological activity prediction by PASS Online, toxicity analysis by ProTox-II, and drug likeness analysis with SWISSADME. Result showed that among the docked compound, hesperidin, cucurbitacin, ginsenoside RH2, and ginsenoside RO had lower binding energy compared to control. Moreover, all of those compounds had comparable hydrogen and hydrophobic interactions with EBOV NP. Further analysis showed it has potential biological function for Ebola disease, such as antiviral, antioxidant, and immunostimulant. All those compounds had low toxicity. As conclusion, there are four promising compounds that potentially inhibited the Ebolavirus proliferation.
Pelatihan Pertanian Secara Vertikultur di Kampung Mejoyo RT 03 RW 07 Surabaya Savitri, Wina Dian; Antonius, Yulanda; Thongiratama, Michael Anthony; Senapati, Laurensius Dewa; William, Leonardo
Aksiologiya: Jurnal Pengabdian Kepada Masyarakat Vol 7 No 2 (2023): Mei
Publisher : Universitas Muhammadiyah Surabaya

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.30651/aks.v7i2.16702

Abstract

Kelompok warga RT 03 RW 07 Mejoyo Surabaya adalah masyarakat yang aktif dan rajin. Kampung ini selalu berprestasi khususnya dalam hal lingkungan hidup dan Usaha Mikro Kecil dan Menengah (UMKM). Program pengabdian masyarakat yang didanai DIKTI ini bertujuan untuk memberdayakan warga kampung dalam hal pertanian sayur organik dengan memanfaatkan lahan sempit yang merupakan sepetak tanah fasilitas umum dari Universitas Surabaya (UBAYA). Selain itu, hasil budidaya sayur diolah sehingga terdapat nilai tambah dan solusi jika panen berlebihan atau hasil panen tidak laku terjual. Agar rintisan usaha ini sukses, warga juga dibekali dengan manajemen keuangan dan pemasaran. Peningkatan kemampuan masyarakat dalam hal pertanian organik vertikultur diukur dengan memberikan pre test dan post test. Hasilnya adalah adanya peningkatan keterampilan warga, yaitu sebesar 16%. Sedangkan keterlibatan mahasiswa Merdeka Belajar Kampus Merdeka (MBKM) di dalam program ini dinilai sangat efektif untuk memperkaya pengalaman mahasiswa dalam mengabdi di masyarakat. Hal ini tertuang dalam nilai keterlibatan masing-masing siswa yaitu antara A dan B.
Pencarian Kandidat Vaksin Tbc Dari Epitope Protein Agj16802.1 (Virulence Factor Mce Family Protein [Mycobacterium Tuberculosis Str. Beijing/Nitr203]) Prasetyaningtyas, Herawati Dwi; Wahjudi, Mariana; Yulanda Antonius
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i9.61696

Abstract

In 2022, the burden of TB in the world was 10,556,328. The incidence of tuberculosis in Indonesia in 2021 was 969,000. The increase in TB incidence in 2021 was 18%. WHO has set a global target and milestone to reduce the incidence of TB by the end of 2030, as well as the Indonesian Ministry of Health. TB can be prevented with the BCG vaccine. BCG avoids phagosome maturation, autophagy, and reduces MHC-II expression of APCs that affect T cell activation by triggering an IgM antibody response, class-switched IgG, to specific proteins ESAT6 and CFP10. Protein subunit vaccines are an option to induce an immune response. Antigens recognized by cells during latent infection and involved in immunological evasion mechanisms or the emergence of CD4+ and CD8+ specific T cells are potential targets. One of these approaches is the incorporation of molecules capable of interacting with PRRs to recognize PAMPs. TLR is found in APC. The recognition of PAMPs by TLRs can result in the expression of co-stimulation molecules as well as the expression of proinflammatory cytokines, TNF-α, COX-2, and interferon associated with the development of adaptive immune responses by B and T lymphocytes. This project aims to determine the possibility of epitopes from protein AGJ68032.1 to be TB vaccine by comparing the results of docking epitope-TLR2 with TLR2-ESAT6. The material used in this project is protein AGJ68032.1 virulence factor Mce family protein [Mycobacterium tuberculosis str. Beijing/NITR203]. The steps were carried out: search for fasta AGJ68032.1, protein similarity test against Mycobacterium tuberculosis protein, determine the location of proteins, search for protein characteristics, find the location of all proteins, search for Bcell epitope, search for Tcell epitope (MHC class 2), epitope similarity test from MHC class 2 with homo sapiens, antigenecity test, allergenicity test, search for the 3D shape of each epitope-TLR2-ESAT-6, molecular docking TLR2 with ESAT-6 and TLR 2 with epitope and comparing the result data Docking. Epitope protein AGJ68031.1 (FAGDDVRIRGVPVGKIVKIEPQPLRAKVSFW) has high potential to be used as a tuberculosis vaccine candidate because the docking results with TLR have a HADDOCK score of -152.5 +/- 7.3 and an RSMD value that is close to the HADDOCK score and the RSMD TLR2 value with ESAT6.
Desain Vaksin Tuberculosis Secara in Silico Untuk Tuberculosis (TBC) Paruparu Agusinta, Astrid Karindra; Wahjudi, Mariana; Antonius, Yulanda
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i11.62348

Abstract

Tuberculosis (TB) is one of the 10 high mortality diseases and causes the highest number of deaths caused by Mycobacterium bacteria. The BCG vaccine is a vaccine given in an effort to prevent tuberculosis (TB). The BCG vaccine contains a weakened strain of TB bacteria which aims to build immunity and encourage the body to fight TB if infected. However, someone who received the vaccine as a child is still at risk of being infected with TB. So an alternative vaccine is needed for TB. The proteins used were human TLR and ESAT-6 as positive controls. The ESAT -6 protein is a protein excreted by bacteria which plays a role in virulence when in the human body. This research aims to design potential tuberculosis vaccine design candidates in silico. The method used is selection of target epitope sequences using NCBI, Prediction of transmembrane peptide signals using Signal IP 5.0 and TMHMM, prediction of epitope interactions with T cell and B cell receptors using IEDB, analysis of antigenicity and allegenicity, prediction of epitope interactions with T cell and B cell receptors using the molecular docking method, and analysis using PDBsum. The results show that AGJ67874, OBK19877, GLB86787 show that each has the potential to be an alternative vaccine when compared to ESAT-6 as a standard epitope. The closest result is GLB86787.
Prediction of Salmon Inhibitor Peptides For DPP-IV Proteins Using Molecular Docking Saputri, Nahdiyah Vernanda; Antonius, Yulanda
Jurnal Biologi Tropis Vol. 26 No. 1 (2026): Januari-Maret
Publisher : Biology Education Study Program, Faculty of Teacher Training and Education, University of Mataram, Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.29303/jbt.v26i1.11310

Abstract

Diabetes mellitus is the 3rd leading cause of death in Indonesia. Glucagon like peptide-1 (GLP-1) and gastric inhibitory polypeptide (GIP) are incretin hormones that function in postpandrial insulin secretion. The purpose of this study was to determine potential peptides from salmon as DPP-IV inhibitors for antidiabetic drugs, using the molecular docking method. This study design refers to several in silico peptide design studies through a bioinformatics approach. The results showed that bioactive peptide molecules derived from salmon, as well as peptide 1 and peptide 2 were predicted as potential molecular peptides and had good interactions with DPP-IV proteins, and were proven to be able to inhibit the DPP-IV enzyme as a target for diabetes mellitus drugs through the identification and evaluation of molecular interactions that occurred using the in silico peptide protein-based molecular binding method. The conclusion is that bioactive peptide molecules derived from salmon, as well as peptide 1 and peptide 2 were predicted as potential molecular peptides and had good interactions with DPP-IV proteins and were proven to be able to inhibit the DPP-IV enzyme.