Claim Missing Document
Check
Articles

Found 5 Documents
Search

PENDAMPINGAN PENGGUNAAN PLATFORM DIGITAL UNTUK MENINGKATKAN PEMASARAN PRODUK UMKM DESA KEBONDALEM Nanda Defi Anita, Nanda; Finatsiyatull Rosida, Dedin; Wardhani Mas’udah, Kusuma; Abidin Achmad, Zainal; Muruah, Iftitan; Almira Nur Aini, Zahra
Jurnal Pengabdian Kepada Masyarakat Patikala Vol. 2 No. 1 (2022): ABDIMAS PATIKALA
Publisher : Education and Talent Development Center of Indonesia (ETDC Indonesia)

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.51574/patikala.v2i1.499

Abstract

Pemasaran merupakan salah satu masalah yang sering dihadapi dalam menjalankan usaha. Kurang luasanya produk UMKM (Usaha Mikro Kecil dan Menengah) dikenal oleh masyarakat, menjadikan UMKM sulit untuk berkembang. UMKM di Desa Kebondalem hanya mengandalkan pemasaran didaerah-daerah terdekat dan juga menerima pesanan dari konsumen atau warga sekitar. Pemanfaatan teknologi platform digital merupakan metode yang ditawarkan oleh kelompok 98 KKN Tematik MBKM UPN “Veteran” Jawa Timur yang terdiri dari 10 anggota dalam bentuk pendampingan terhadap UMKM yang memang benar-benar ingin dibantu. Inovasi pemasaran menggunakan platform digital oleh pelaku UMKM merupakan cara terkini dan memiliki prospek tinggi untuk berhasil, sehingga masalah pemasaran dapat teratasi. Berdasarkan 21 data UMKM yang diperoleh terdapat 2 UMKM yang membutuhkan pendampingan untuk mengatasi masalah tersebut. 2 UMKM tersebut yaitu Kripik Madam dan Kerupuk Open 3 Putri. Pendampingan yang akan dilakukan untuk menghadapi masalah pemasaran ini dilaksanakan selama 3 bulan dengan kegiatan edukasi marketing, pembuatan atau revisi logo, foto produk, penggunaan sosial media dan adanya FGD (Forum Group Discussion) mengenai perkembangan sosial media. Setelah dilakukan pendampingan hampir selama 3 bulan, terlihat adanya perkembangan dari UMKM. Perkembangan tersebut dilihat dari awalnya 2 UMKM tersebut tidak memiliki social media, sekarang sudah memiliki. Selain itu akun sosial media sudah dilakukan upload foto produk dengan caption dan tagline yang menarik, bahkan sudah mampu menarik perhatian konsumen untuk membeli produk 2 UMKM tersebut. Kegiatan pemasaran offline yang sudah dilakukan oleh UMKM memiliki strategi sendiri untuk menarik konsumen, hal tersebut harus tetap dilanjutkan. Pemasaran menggunakan platform digital merupakan suatu metode baru untuk mempromosikan produk agar dikenal oleh masyarakat luas. Oleh karena itu, alangkah baiknya pemasaran offline dan online saling berkolaborasi untuk dilakukan agar produk dapat dikenal secara luas, meningkatkan penjualan serta mampu mengembangkan UMKM.
PENDAMPINGAN PENGGUNAAN PLATFORM DIGITAL UNTUK MENINGKATKAN PEMASARAN PRODUK UMKM DESA KEBONDALEM Nanda Defi Anita, Nanda; Finatsiyatull Rosida, Dedin; Wardhani Mas’udah, Kusuma; Abidin Achmad, Zainal; Muruah, Iftitan; Almira Nur Aini, Zahra
Jurnal Pengabdian Kepada Masyarakat Patikala Vol. 2 No. 1 (2022): Jurnal PkM PATIKALA
Publisher : Education and Talent Development Center of Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.51574/patikala.v2i1.499

Abstract

Pemasaran merupakan salah satu masalah yang sering dihadapi dalam menjalankan usaha. Kurang luasanya produk UMKM (Usaha Mikro Kecil dan Menengah) dikenal oleh masyarakat, menjadikan UMKM sulit untuk berkembang. UMKM di Desa Kebondalem hanya mengandalkan pemasaran didaerah-daerah terdekat dan juga menerima pesanan dari konsumen atau warga sekitar. Pemanfaatan teknologi platform digital merupakan metode yang ditawarkan oleh kelompok 98 KKN Tematik MBKM UPN “Veteran” Jawa Timur yang terdiri dari 10 anggota dalam bentuk pendampingan terhadap UMKM yang memang benar-benar ingin dibantu. Inovasi pemasaran menggunakan platform digital oleh pelaku UMKM merupakan cara terkini dan memiliki prospek tinggi untuk berhasil, sehingga masalah pemasaran dapat teratasi. Berdasarkan 21 data UMKM yang diperoleh terdapat 2 UMKM yang membutuhkan pendampingan untuk mengatasi masalah tersebut. 2 UMKM tersebut yaitu Kripik Madam dan Kerupuk Open 3 Putri. Pendampingan yang akan dilakukan untuk menghadapi masalah pemasaran ini dilaksanakan selama 3 bulan dengan kegiatan edukasi marketing, pembuatan atau revisi logo, foto produk, penggunaan sosial media dan adanya FGD (Forum Group Discussion) mengenai perkembangan sosial media. Setelah dilakukan pendampingan hampir selama 3 bulan, terlihat adanya perkembangan dari UMKM. Perkembangan tersebut dilihat dari awalnya 2 UMKM tersebut tidak memiliki social media, sekarang sudah memiliki. Selain itu akun sosial media sudah dilakukan upload foto produk dengan caption dan tagline yang menarik, bahkan sudah mampu menarik perhatian konsumen untuk membeli produk 2 UMKM tersebut. Kegiatan pemasaran offline yang sudah dilakukan oleh UMKM memiliki strategi sendiri untuk menarik konsumen, hal tersebut harus tetap dilanjutkan. Pemasaran menggunakan platform digital merupakan suatu metode baru untuk mempromosikan produk agar dikenal oleh masyarakat luas. Oleh karena itu, alangkah baiknya pemasaran offline dan online saling berkolaborasi untuk dilakukan agar produk dapat dikenal secara luas, meningkatkan penjualan serta mampu mengembangkan UMKM.
Effect of the Addition of Tapioca Flour and Moringa Leaf Puree (Moringa oleifera) on Proximate Analysis of Shellfish Siomay Nurun Nafiah, Nisa; Finatsiyatull Rosida, Dedin
AJARCDE (Asian Journal of Applied Research for Community Development and Empowerment) Vol. 9 No. 1 (2025)
Publisher : Asia Pacific Network for Sustainable Agriculture, Food and Energy (SAFE-Network)

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.29165/ajarcde.v9i1.625

Abstract

Moringa leaf puree is rich in amino acids, making it a valuable nutritional ingredient, while tapioca flour, due to its amylose and amylopectin content, enhances the chewiness of food products. Mollusks, particularly clams and snails, are excellent sources of protein and minerals. This study aimed to evaluate the effects of tapioca flour and moringa leaf puree addition on the nutritional composition of siomay made from shellfish. A randomized block design with two factors was employed: (1) the type of shellfish (blood clam, green clam, and rice snail) and (2) the proportion of tapioca flour to moringa leaf puree (50:50, 75:25, and 100:0). The best formulation was obtained from siomay made with rice snail and a tapioca flour-to-moringa puree ratio of 75:25, yielding a moisture content of 50.14%, ash content of 5.6%, fat content of 2.82%, protein content of 9.84%, and carbohydrate content of 31.60%. Contribution to Sustainable Development Goals (SDGs):SDG 2: Zero Hunger. SDG 3: Good Health and Well-being.  SDG 12: Responsible Consumption and Production. SDG 14: Life Below Water
Pengembangan Potensi Mangrove sebagai Produk Pangan Fungsional di Kecamatan Wonorejo Surabaya Yulistiani, Ratna; Finatsiyatull Rosida, Dedin; Savitri, Anggita; Meireni Zacharya, Berlianda
Journal of Science and Social Development Vol. 6 No. 2 (2023): Journal of Science and Social Development
Publisher : Universitas Nahdlatul Ulama Sidoarjo

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.55732/jssd.v6i2.1064

Abstract

One of the coastal areas that has large areas of potential mangroves is Wonorejo District, East Surabaya. The Wonorejo Mangrove Ecotourism concept provides economic benefits for people who have creative small industries to improve people's living standards. Pedada fruit (Sonnerita spp) is one of the products of mangrove forests which is rich in nutritional content, rich in antioxidants and dietary fiber which has great potential to be developed as a functional food product. The UPN Veteran East Java community service program in the "UPN Serves" scheme has developed the potential of mangroves (Pedada fruit and Pedada Pulp Flour) into functional food products based on local food. The aim of this community service program is to encourage Wonorejo Mangrove Farmer Group partners to further increase the potential of mangroves as a functional food product to improve the economy and preserve the environment through creative small industries with an appropriate technological approach. The approach method used is in the form of surveys, provision and technical training/guidance, as well as mentoring. The results of the activity show that through knowledge transfer, mentoring and training on appropriate technology, functional food products from pedada fruit and pedada fruit pulp flour have attracted the interest and participation of partners to further utilize the potential of mangroves as functional food products, as well as opening up business opportunities from these activities. The functional products created from this program are Pedada Cookies high in fiber and antioxidants, Pedada Onion Sticks high in fiber, Pedada Fruit Jam high in fiber and vitamin C, and Pedada Jelly Candy high in collagen and vitamin C. The output of this program is Appropriate Technology food products The functional function of mangroves is expected to be a commercial product and superior product of the Wonorejo Surabaya Mangrove Farmers group.
Potential of flavor enhancer from crude hydrolysate derived from Pomacea canaliculata and Filopaludina javanica using papain Yusuf Trisna Putra, Andre; Finatsiyatull Rosida, Dedin; Dany Priyanto, Anugerah; Kongpichitchoke, Teeradate; Havanapan, Phattara-Orn
jurnal1 VOLUME 8 ISSUE 2, DECEMBER 2025
Publisher : Hasanuddin University Food Science and Technology Study Program

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.20956/canrea.v8i2.1149

Abstract

Enzymatic hydrolysis is an effective technique for breaking down proteins into peptides and free amino acids. Among the amino acids released, glutamic acid (glutamate) plays a key role in generating the umami taste in snails. This study aimed to produce a natural flavor enhancer through the enzymatic hydrolysis of proteins derived from Pomacea canaliculata (PCP) and Filopaludina javanica (FJP) using papain enzyme. The hydrolysis process was conducted by adding papain to PCP and FJP slurries at different enzyme-to-substrate (E/S) ratios of 1:10, 1:20, and 1:100 (w/v). The reaction was carried out at 54 °C for 3, 6, 9, 12, 15, and 18 hours. After incubation, the supernatant was collected and analyzed for the degree of hydrolysis, total peptide content, total amino acids, sensory properties, and peptide sequence identification using LC-ESI-MS/MS. The highest degree of hydrolysis was obtained at an E/S ratio of 1:10 after 18 hours, yielding 89.28% for PCP and 76.27% for FJP. The highest peptide concentrations were 15.28 mg/mL and 8.60 mg/mL for PCP and FJP hydrolysates, respectively. Increasing enzyme concentration positively influenced panelists’ preferences for taste, color, and aroma attributes. The identified umami peptides from PCP and FJP typically contained 8–39 amino acids. In the PCP hydrolysate, Ala and Gly residues were identified at the N-terminal region of several peptides, including AVGLSHSNNTKDVMEKSK, GFMCSVDDQHTSSVLLLSYNAITGLGFTTCVTMIA, and GEMAAHYGTMDGGPGM. In the FJP hydrolysate, Gly was predominantly present at the N-terminal of peptides such as GLPGLPGLPGPK, GPLGPLGPQGIP, and GMMPPGMMPPEGMPP