Claim Missing Document
Check
Articles

Found 10 Documents
Search

Deteksi Gen SHV pada Isolat Klinik Eschericia coli Penghasil Extended Spectrum Beta-Lactamases (ESBLs) dari Urin Pasien di RSUD Dr. Soetomo Surabaya Prasetya, Yulianto Ade
Bioeksperimen: Jurnal Penelitian Biologi Vol 4, No 2: September 2018
Publisher : Universitas Muhammadiyah Surakarta

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.23917/bioeksperimen.v4i2.6884

Abstract

Esherichia coli ESBLs bertanggungjawab terhadap terjadinya wabah infeksi nosokomial, peningkatan morbiditas dan mortalitas, serta peningkatan biaya kesehatan. Tujuan penelitian ini yakni untuk mendeteksi keberadaan gen SHV pada isolat klinik E.coli penghasil ESBLs dari urine pasien yang merupakan koleksi Laboratorium Mikrobiologi Klinik RSUD Dr. Soetomo Surabaya pada bulan Januari - Februari 2014. Jenis penelitian yang digunakan adalah observasional deskriptif dengan pendekatan molekul genetik. Metode yang digunakan untuk deteksi gen SHV menggunakan PCR (Polymerase ChainReaction) kemudian dielektroforesis dan divisualisasikan pada gel agarose 1.5%. Hasil penelitian menunjukkan bahwa dari tiga puluh isolat, sebanyak dua belas isolat (40%) positif mengandung gen SHV.
Identifikasi Gen Ctx-M Pada Esherichia Coli Penghasil Extended Spectrum Beta-Lactamases (Esbls) Di RSUD Dr. Soetomo surabaya Prasetya, Yulianto Ade
Jurnal Teknologi Laboratorium Vol 6 No 2 (2017): 2017 (2)
Publisher : POLTEKKES KEMENKES YOGYAKARTA

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (375.608 KB) | DOI: 10.29238/teknolabjournal.v6i2.92

Abstract

Escherichia coli producing Extended-Spectrum Beta-Lactamases (ESBLs) responsible for the high number of disease and death from nosocomial infections because of an enzyme encoded by genes CTX-M. This aim of the research to identify isolates E.coli of urine patients, which is a collection of Clinical Microbiology RSUD Dr. Soetomo Surabaya on the January-February 2014. The kind of the research use is observational descriptive with molecule approachment. The sample used in clinical isolate of E.coli producing ESBLs accumulated during January-February 2014 collection Clinical Laboratory RSUD Dr. Soetomo Surabaya that is thirty isolate. The methods used for the detection of genotypic by PCR thus electrophoresis and visualized on agarose gel 1.5%. The results show that twenty-seven isolate (90%) positive containing a gen CTX-M with the highest number found on the Interna Departement. Detection Bacteria producing ESBLs in genotype important that therapy an antibiotic the patients are given more effective and efficient.
Eksplorasi Keanekaragaman Kupu-Kupu (Lepidoptera) dan Status Konservasinya di Taman Nasional Gunung Merbabu Jawa Tengah Prasetya, Yulianto Ade; Nisyak, Khoirun; Hisbiyah, A'yunil; Ifititah, Elvina Dhiaul; Srihardiyastuti, Arie
Indonesian Journal of Mathematics and Natural Sciences Vol 42, No 1 (2019): April 2019
Publisher : Universitas Negeri Semarang

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Extended Spectrum Beta Lactamases (ESBLs) merupakan enzim yang mampu menonaktifkan antibiotik golongan beta laktam generasi ketiga dan keempat, serta monobaktam. Escherichia coli merupakan kelompok Enterobacteriaceae yang paling banyak ditemukan menghasilkan enzim ESBLs. Hal tersebut menyebabkan semakin meningkatnya biaya perawatan di rumah sakit, angka kesakitan, dan angka kematian di berbagai negara, termasuk di Indonesia. Penelitian ini bertujuan untuk mengetahui aktivitas nanokomposit ZnO-Ag dalam menghambat pertumbuhan bakteri Escherichia coli penghasil ESBLs. Nanokomposit ZnO-Ag dibuat dengan metode refluks secara one pot synthesis menggunakan minyak cengkeh sebagai reduktor melalui green synthesis. Nanokomposit ZnO-Ag yang terbentuk yakni 73,21 nm kemudian diujikan pada bakteri E.coli penghasil ESBLs dengan metode Kirby-Bauer. Konsentrasi nanokomposit 100 µg/ml merupakan konsentrasi yang efektif dalam menghambat pertumbuhan E.coli penghasil ESBLs.
Edukasi Pola Makan Sehat kepada Pasien Peserta Prolanis Di Puskesmas Trosobo Sidoarjo Nisyak, Khoirun; Amanda, Eviomitta Rizki; Hisbiyah, A’yunil; Prasetya, Yulianto Ade; Nurdianto, Arif Rahman
DHARMA BAKTI Dharma Bakti- Vol 4 No 2 - Oktober 2021
Publisher : LPPM IST AKPRIND Yogyakarta

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Participants of the Chronic Disease Management Program (PROLANIS) at the Trosobo Health Center are a group of patients with diabetes mellitus and hypertension whose condition needs to be monitored regularly. Diet is one of the important factors that affect the stability of the health condition of patients in the Prolanis group. The purpose of this program is to provide education on healthy eating patterns for Prolanis participants. The method of activities carried out is counseling and workshops with a total of 30 patients. Counseling activities and workshops are carried out by involving families who care for patients. Evaluation of the success of the program is determined by the patient's level of understanding about healthy eating patterns and fasting blood sugar levels and the patient's blood pressure to normal and stable levels over time. Based on the results of the program evaluation that has been carried out, 90% of Prolanis patients understand about healthy eating patterns and apply them in their daily lives.
DETEKSI FENOTIPIK Escherichia coli PENGHASIL EXTENDED SPECTRUM BETA-LACTAMASES (ESBLS) PADA SAMPEL MAKANAN DI KRIAN SIDOARJO Prasetya, Yulianto Ade; Winarsih, Ike Yuyun; Pratiwi, Kharisma Aprilia; Hartono, Merinsa Chorry; Rochimah, Dita Nur
Life Science Vol 8 No 1 (2019): April 2019
Publisher : Universitas Negeri Semarang

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/lifesci.v8i1.30000

Abstract

Escherichia coli is a group of Enterobacteriaceae bacteria that often contaminate food so that it can cause diarrhea. These bacteria are very difficult to treat if they are able to produce the Extended-Spectrum Beta-Lactamases (ESBLs) enzyme. The purpose of this study was to identify ESBLs-producing E. coli in food samples in Krian Sidoarjo. Food samples (fried foods, cilok tempura and chili sauce) were collected from ten different places. The sample was then grown on Eosin Methylene Blue (EMB) medium and purified by the 16 streak method, as well as biochemical character tests. The ESBLs phenotypic E. coli method was carried out by screening test and confirmation test using a Double Disk Synergy Test (DDST). Thirty colonies were able to grow on EMB media, but after microscopic identification and biochemistry testing only four samples were E. coli positive and were able to produce ESBLs from the phenotypic test that had been carried out. ESBLs-producing E. coli testing is important not only for nosocomial infections but also for the community so it needs attention to the spread of ESBLs resistance among microorganism species Escherichia coli termasuk kelompok bakteri Enterobacteriaceae yang sering mengkontaminasi makanan sehingga dapat menyebabkan diare. Bakteri ini sangat sulit diobati apabila mampu memproduksi enzim Extended Spectrum Beta-Lactamases (ESBLs). Tujuan penelitian ini adalah untuk mengindetifikasi E. coli penghasil ESBLs pada sampel makanan di Krian Sidoarjo. Sampel makanan (gorengan, cilok, tempura, dan saus sambal) dikumpulkan dari sepuluh tempat berbeda. Sampel kemudian ditumbuhkan pada medium Eosin Metilen Blue (EMB) dan dimurnikan dengan metode streak 16, serta dilakukan karakteristik uji biokimia. Metode fenotipik E. coli penghasil ESBLs dilakukan dengan uji skrining dan uji konfirmasi menggunakan double disk synergy test (DDST). Sebanyak tiga puluh koloni mampu tumbuh pada media EMB, namun setelah diidentifikasi mikroskopis dan uji biokiomia hanya empat sampel positif E. coli dan mampu menghasilkan ESBLs dari uji fenotipik yang telah dilakukan. Pengujian E. coli penghasil ESBLs penting dilakukan bukan hanya pada infeksi nosokomial, tetapi juga pada komunitas sehingga perlu mendapat perhatian terhadap penyebaran resistensi ESBLs diantara spesies mikroorganisme Keywords: Escherichia coli, Extended Spectrum Beta Lactamases, Fenotopik, Makanan, Sidoarjo, Phenotypic, Food
Aktivitas Nanoemulsi Minyak Lengkuas (Alpinia galanga [L] Willd) dalam Menghambat Bakteri Escherichia coli Penghasil Extended Spectrum Beta Lactamases (ESBLs) Prasetya, Yulianto Ade; Nisya, Khoirun; Amanda, Eviomitta Rizki
Prosiding SNPBS (Seminar Nasional Pendidikan Biologi dan Saintek) 2019: Prosiding SNPBS (Seminar Nasional Pendidikan Biologi dan Saintek)
Publisher : Universitas Muhammadiyah Surakarta

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (433.86 KB)

Abstract

Escherichia coli merupakan bakteri yang mampu mendegradasi antibiotik golongan beta laktam generasi ketiga, keempat serta monobaktam. Bakteri E.coli penghasil ESBLs membuat pilihan antibiotik menjadi semakin terbatas untuk pengobatan sehingga bertanggungjawab terhadap peningkatan angka kesakitan, kematian, dan biaya kesehatan. Minyak lengkuas merupakan tanaman asli Indonesia yang terbukti mampu melawan bakteri patogen namun penelitian untuk bakteri penghasil ESBLs belum pernah dilaporkan. Minyak atsiri dalam bentuk nano mampu meningkatkan luas permukaan sehingga lebih efektif dan efisien untuk pengobatan. Penelitian ini bertujuan untuk mengetahui aktivitas nanoemulsi minyak lengkuas dalam menghambat bakteri E.coli penghasil ESBLs. Nanoemulsi dibuat dengan bantuan sonikator amplitudo 20% dan dikarakterisasi menggunakan Particle Size Analyzer (PSA). Nanoemulsi yang dibuat kemudian diujikan aktivitasnya pada E.coli penghasil ESBLs dengan spektofotometer panjang gelombang 600nm dengan seri pengenceran 0.35, 0.7, 1.4, 2.8, 5.6, 11.2, dan 22.5 μg/ml. Hasil penelitian menunjukkan bahwa Nanoemulsi dengan ukuran 490,3 mampu menghambat bakteri uji pada konsentrasi 0.7 μg/ml. dengan waktu inkubasi 24 jam dan 11.2 μg/ml.
Potensi Nanokomposit Sengoksida-Perak (ZnO-Ag) Metode Gelombang Mikro dalam Menghambat Pertumbuhan BAKTERI Escherichia coli Penghasil Extxtended Spectrum Beta Lactamases (ESBLs) Prasetya, Yulianto Ade; Nisyak, Khoirun; Hisbiyah, A'yunil
Prosiding SNPBS (Seminar Nasional Pendidikan Biologi dan Saintek) 2020: Prosiding SNPBS (Seminar Nasional Pendidikan Biologi dan Saintek)
Publisher : Universitas Muhammadiyah Surakarta

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (698.219 KB)

Abstract

Escherichia coli penghasil Extended Spectrum Beta Lactamases (ESBLs) merupakan bakteri yang mampu menghidrolisis antibiotik golongan beta laktam generasi kedua dan ketiga serta monobaktam. Bakteri ini menyebabkan insidensi tertinggi infeksi saluran kemih (ISK) yang utama di seluruh dunia. Seng oksida (ZnO) terbukti mampu melawan resistensi bakteri sedangkan perak (Ag) mampu melawan bakteri dengan menghambat sintesis dinding sel, protein, dan metabolisme sel. Nanokomposit merupakan penggabungan antara ZnO dan Ag yang berukuran nanometer (nm) dengan bantuan instrumen berupa microwave termodifikasi. Nanokomposit yang terbentuk dikarakterisasi dengan X-Ray Diffractometer (XRD) untuk mengetahui ukuran dan kristanilitas yang terbentuk. Uji aktivitas nanokomposit ZnO-Ag dilakukan dengan metode difusi sumuran menggunakan cock borer pada media Mueller-Hinton agar. Hasil yang didapatkan menunjukkan bahwa nanokomposit yang terbentuk berukuran 124,71 nm. Nanokomposit ZnO-Ag mampu menghambat bakteri E. coli penghasil ESBLs dengan diameter zona hambat yakni 11,35 mm. Nanokomposit ZnO-Ag berpotensi untuk dikembangkan sebagai alat medis berbasis nanokomposit ZnO-Ag dalam melawan bakteri penyebab infeksi nosokomial, salah satunya E. coli penghasil Extended Spectrum Beta Lactamases (ESBLs).
Deteksi Gen SHV pada Isolat Klinik Eschericia coli Penghasil Extended Spectrum Beta-Lactamases (ESBLs) dari Urin Pasien di RSUD Dr. Soetomo Surabaya Prasetya, Yulianto Ade
Bioeksperimen: Jurnal Penelitian Biologi Vol 4, No 2: September 2018
Publisher : Universitas Muhammadiyah Surakarta

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.23917/bioeksperimen.v4i2.6884

Abstract

Esherichia coli ESBLs bertanggungjawab terhadap terjadinya wabah infeksi nosokomial, peningkatan morbiditas dan mortalitas, serta peningkatan biaya kesehatan. Tujuan penelitian ini yakni untuk mendeteksi keberadaan gen SHV pada isolat klinik E.coli penghasil ESBLs dari urine pasien yang merupakan koleksi Laboratorium Mikrobiologi Klinik RSUD Dr. Soetomo Surabaya pada bulan Januari - Februari 2014. Jenis penelitian yang digunakan adalah observasional deskriptif dengan pendekatan molekul genetik. Metode yang digunakan untuk deteksi gen SHV menggunakan PCR (Polymerase ChainReaction) kemudian dielektroforesis dan divisualisasikan pada gel agarose 1.5%. Hasil penelitian menunjukkan bahwa dari tiga puluh isolat, sebanyak dua belas isolat (40%) positif mengandung gen SHV.
Design of Casocidin-II Mutation Variants as Antibacterial Candidates against Helicobacter pylori using Bioinformatic Approaches Prasetya, Yulianto Ade; Kok, Tjie
MPI (Media Pharmaceutica Indonesiana) Vol. 7 No. 2 (2025): DECEMBER
Publisher : Fakultas Farmasi, Universitas Surabaya

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.24123/mpi.v7i2.7601

Abstract

Helicobacter pylori infects about 50% of the global population, with high prevalence in Indonesia, particularly in East Nusa Tenggara (51.4%) and Papua (30.7%). If untreated, this infection can cause gastritis, ulcers, and even gastric cancer. Due to rising antibiotic resistance to this bacterium, alternative treatments are needed. Casocidin-II, an antimicrobial peptide from cows milk (Bos taurus), has antibacterial potential but it is unstable in acidic environments, making it ineffective against H. pylori, which colonizes in the stomach. This research aims to design and analyze Casocidin-II mutations using bioinformatic approaches to improve stability without reducing antibacterial activity. Mutations were conducted using I-Mutant 2.0, and structural modeling was done with PEP-FOLD4. Physicochemical properties were analyzed with ExPASy, and the binding affinity to H. pylori BabA receptor was evaluated using HADDOCK. Molecular interactions were visualized with ChimeraX. Eight stable Casocidin- II mutants (CAS1–CAS8) were identified, with CAS3 and CAS5 showing the best stability, hydrophilicity, and aliphatic index. Docking results showed CAS3 and CAS7 had the highest binding affinities, -121.70 kcal/mol and -123.24 kcal/mol, respectively. CAS3, with the sequence KTKLTVEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK, was the most effective in inhibiting H. pylori growth and is a strong candidate for further laboratory testing. Besides its high affinity and activity, CAS3’s amino acid profile enhaces target binding and membrane penetration. This research demonstrates that bioinformatics can be used in designing mutation varians to enhance peptide stability and antibacterial properties. CAS3 is a promising alternative to conventional antibiotics for H. pylori treatment, pending further experimental validation.
Analisis Penambatan Molekuler Hidrokarbon Seskuiterpen Gaharu Merauke terhadap protein pengikat penisilin pada Acinetobacter baumanii Prasetya, Yulianto Ade; Luqman, Arif
JURNAL RISET KESEHATAN POLTEKKES DEPKES BANDUNG, Online ISSN 2579-8103 Vol 18 No 1 (2026): Jurnal Riset Kesehatan Poltekkes Depkes Bandung
Publisher : Poltekkes Kemenkes Bandung

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.34011/juriskesbdg.v18i1.3219

Abstract

Background: Acinetobacter baumannii is a critical nosocomial pathogen associated with a high level of antibiotic resistance, necessitating the exploration of alternative antibacterial candidates from natural sources. Merauke agarwood (Aquilaria malaccensis) essential oil contains various sesquiterpenes; however, molecular-level evidence targeting A. baumannii penicillin-binding proteins (PBPs) remains limited. Objective: This study evaluated the interactions of selected sesquiterpene hydrocarbons, γ-cadinene, kessane, and α-gurjunene, from Merauke agarwood using an in silico approach. Methods: Drug-likeness and ADMET properties were predicted using ADMETLab 3.0, while potential biological activities were assessed with PASS Online. Molecular docking was performed against A. baumannii PBP1a (3UE3) and PBP3 (3UDF) using CB-Dock2, followed by protein–ligand interaction analysis with PLIP. Results: All compounds complied with Lipinski’s rule and showed moderate quantitative estimates of drug-likeness, although high lipophilicity and plasma protein binding were predicted. Docking analysis revealed moderate binding affinities toward both PBPs (−6.2 to −6.7 kcal/mol) and identified conserved hydrophobic interaction regions involving recurrent amino acid residues within each protein. PASS predictions indicated higher probabilities of antibacterial-related activity than inactivity for all ligands Conclusions: These sesquiterpene hydrocarbons from agarwood form stable interactions with A. baumannii PBPs, providing a structural basis for lead scaffolds in structure-based screening. Further studies on oxygenated derivatives, formulation strategies, and experimental validation are recommended. These sesquiterpene hydrocarbons from agarwood form stable interactions with A. baumannii PBPs, providing a structural basis for lead scaffolds in structure-based screening. Further studies on oxygenated derivatives, formulation strategies, and experimental validation are recommended.