Article Per Year (5 Year)
p-Index From 2021 - 2026
1.642
P-Index
This Author published in this journals
All Journal CALYPTRA : Jurnal Ilmiah Mahasiswa Universitas Surabaya Jurnal Farmasi Klinik Indonesia MPI (Media Pharmaceutica Indonesiana) Molecular and Cellular Biomedical Sciences (MCBS) Syntax Literate: Jurnal Ilmiah Indonesia Jurnal Ilmiah Kesehatan Rustida Keluwih: Jurnal Sains dan Teknologi Pharmaceutical Sciences and Research (PSR) Tropical Genetics
Mariana Wahjudi, Mariana
Universitas Surabaya
Agriculture, Biological Sciences & Forestry Humanities Biochemistry, Genetics & Molecular Biology Chemical Engineering, Chemistry & Bioengineering Chemistry Computer Science & IT Dentistry Education Electrical & Electronics Engineering Energy Engineering Environmental Science Health Professions Immunology & microbiology Industrial & Manufacturing Engineering Law, Crime, Criminology & Criminal Justice Materials Science & Nanotechnology Mechanical Engineering Medicine & Pharmacology Neuroscience Nursing Public Health Social Sciences Other

Published : 14 Documents Claim Missing Document
Claim Missing Document
Check
Articles

Found 2 Documents
Search
Journal : Syntax Literate: Jurnal Ilmiah Indonesia

 1 
Pencarian Kandidat Vaksin Tbc Dari Epitope Protein Agj16802.1 (Virulence Factor Mce Family Protein [Mycobacterium Tuberculosis Str. Beijing/Nitr203]) Prasetyaningtyas, Herawati Dwi; Wahjudi, Mariana; Yulanda Antonius
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i9.61696

Abstract

In 2022, the burden of TB in the world was 10,556,328. The incidence of tuberculosis in Indonesia in 2021 was 969,000. The increase in TB incidence in 2021 was 18%. WHO has set a global target and milestone to reduce the incidence of TB by the end of 2030, as well as the Indonesian Ministry of Health. TB can be prevented with the BCG vaccine. BCG avoids phagosome maturation, autophagy, and reduces MHC-II expression of APCs that affect T cell activation by triggering an IgM antibody response, class-switched IgG, to specific proteins ESAT6 and CFP10. Protein subunit vaccines are an option to induce an immune response. Antigens recognized by cells during latent infection and involved in immunological evasion mechanisms or the emergence of CD4+ and CD8+ specific T cells are potential targets. One of these approaches is the incorporation of molecules capable of interacting with PRRs to recognize PAMPs. TLR is found in APC. The recognition of PAMPs by TLRs can result in the expression of co-stimulation molecules as well as the expression of proinflammatory cytokines, TNF-α, COX-2, and interferon associated with the development of adaptive immune responses by B and T lymphocytes. This project aims to determine the possibility of epitopes from protein AGJ68032.1 to be TB vaccine by comparing the results of docking epitope-TLR2 with TLR2-ESAT6. The material used in this project is protein AGJ68032.1 virulence factor Mce family protein [Mycobacterium tuberculosis str. Beijing/NITR203]. The steps were carried out: search for fasta AGJ68032.1, protein similarity test against Mycobacterium tuberculosis protein, determine the location of proteins, search for protein characteristics, find the location of all proteins, search for Bcell epitope, search for Tcell epitope (MHC class 2), epitope similarity test from MHC class 2 with homo sapiens, antigenecity test, allergenicity test, search for the 3D shape of each epitope-TLR2-ESAT-6, molecular docking TLR2 with ESAT-6 and TLR 2 with epitope and comparing the result data Docking. Epitope protein AGJ68031.1 (FAGDDVRIRGVPVGKIVKIEPQPLRAKVSFW) has high potential to be used as a tuberculosis vaccine candidate because the docking results with TLR have a HADDOCK score of -152.5 +/- 7.3 and an RSMD value that is close to the HADDOCK score and the RSMD TLR2 value with ESAT6.
Desain Vaksin Tuberculosis Secara in Silico Untuk Tuberculosis (TBC) Paruparu Agusinta, Astrid Karindra; Wahjudi, Mariana; Antonius, Yulanda
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i11.62348

Abstract

Tuberculosis (TB) is one of the 10 high mortality diseases and causes the highest number of deaths caused by Mycobacterium bacteria. The BCG vaccine is a vaccine given in an effort to prevent tuberculosis (TB). The BCG vaccine contains a weakened strain of TB bacteria which aims to build immunity and encourage the body to fight TB if infected. However, someone who received the vaccine as a child is still at risk of being infected with TB. So an alternative vaccine is needed for TB. The proteins used were human TLR and ESAT-6 as positive controls. The ESAT -6 protein is a protein excreted by bacteria which plays a role in virulence when in the human body. This research aims to design potential tuberculosis vaccine design candidates in silico. The method used is selection of target epitope sequences using NCBI, Prediction of transmembrane peptide signals using Signal IP 5.0 and TMHMM, prediction of epitope interactions with T cell and B cell receptors using IEDB, analysis of antigenicity and allegenicity, prediction of epitope interactions with T cell and B cell receptors using the molecular docking method, and analysis using PDBsum. The results show that AGJ67874, OBK19877, GLB86787 show that each has the potential to be an alternative vaccine when compared to ESAT-6 as a standard epitope. The closest result is GLB86787.
Co-Authors Ade Prasetya, Yulianto Agusinta, Astrid Karindra Amelia Lorensia Andayani, Tri M. Antonius, Yulanda Apriyani, Dhea Orinta Castoeri, Yeslia Naomi Dewi, Ni Putu Nila Sulistia Doddy de Queljoe, Doddy de Erdiansyah, Muhammad Islamie, Ridho Iwansyah, Assidiq Zidane Maranatha, Daniel Marisca Evalina Gondokesumo, Marisca Evalina Meira, Gracelynn Novandrie Zakharia Daud Novandrie Zakharia Daud, Novandrie Zakharia Nurrosyidah, Iif Hanifa Prasetyaningtyas, Herawati Dwi Raharjo, Dian Natasya Saksono, Astrella Amanda Putri Santoso, Hadinata Simanjuntak, Inana Ratu Soripada Suryadinata, Rivan V. Suryadjaya, Ernest Tungary, Emilia Wartini, Luh Risma Wonggo, Dhammiko