cover
Contact Name
Yudhi Nugroho Adi
Contact Email
library@tekomuniversity.ac.id
Phone
+628128000110
Journal Mail Official
library@telkomuniversity.ac.id
Editorial Address
Jl. Telekomunikasi - Ters. Buah Batu Bandung 40257 Indonesia
Location
Kota bandung,
Jawa barat
INDONESIA
eProceedings of Engineering
Published by Universitas Telkom
ISSN : 23559365     EISSN : -     DOI : https://doi.org/10.34818/eoe.v9i5.18452
Merupakan media publikasi karya ilmiah lulusan Universitas Telkom yang berisi tentang kajian teknik. Karya Tulis ilmiah yang diunggah akan melalui prosedur pemeriksaan (reviewer) dan approval pembimbing terkait.
Articles 8,304 Documents
Klasifikasi Efek Familiarity Pada Sinyal Eeg Manusia Menggunakan Metode Hjorth Descriptor : Classification Of Familiarity Effects In Human Eeg Signal Using Hjorth Descriptor Method Hannissa Sanggarini; Rita Purnamasari; Sugondo Hadiyoso
eProceedings of Engineering Vol 6, No 1 (2019): April 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstrak Dalam Human-Computer Interaction, audiovisual sangat berpengaruh bagi kondisi fisiologis yang mempengaruhi perasaan manusia. Hal ini dapat dilihat dari kemampuan manusia yang mampu merasakan perasaan yang berbeda-beda saat melihat tayangan video musik. Perasaan ini muncul akibat stimulus yang dihasilkan dari tayangan video musik tersebut sehingga terjadi fluktuasi aktifitas otak dan menghasilkan karakteristik sinyal otak tertentu. Dengan menggunakan Electroencephalogram (EEG), dilakukan klasifikasi karakteristik sinyal otak pada kategori familiarity. Familiarity adalah keadaan saat manusia mengenali sesuatu. Penelitian ini menggunakan data sekunder yang diambil dari DEAP: A Database for Emotion Analysis using Physiological Signals. Data yang diambil dari DEAP berjumlah 32 data yang telah melalui beberapa tahap pre-processing, maka data dapat langsung diproses dengan menggunakan metode Hjorth Descriptor untuk ekstraksi ciri dan metode Multilayer Perceptron (MLP) untuk klasifikasi. Pengujian dilakukan dengan skenario dimana data dari 29 data yang digunakan, 15 data digunakan sebagai data latih dan 14 data digunakan sebagai data uji. Dari hasil pengujian yang dilakukan, didapatkan akurasi terbaik pada kondisi balance class sebesar 78.57% pada percobaan 1, 2 dan 27 dengan kombinasi ciri Hjorth Descriptor activity, mobility dan complexity. Digunakan juga dua hidden layer dengan 12 neurons pada tiap hidden layer serta epoch berjumlah 1.000 epochs pada MLP. Kata Kunci: EEG, familiar, Hjorth Descriptor, Multilayer Perceptron. Abstract In Human-Computer Interaction, audiovisual is very influential for physiological condition that affects human’s feelings. This can be seen from human ability to feel different feelings while watching music video. This feeling occured because of the stimulus elicited from the music video, so that brain activity fluctuation happened and obtained certain brain signals characteristics. By using Electroencephalogram (EEG), we did a classification of brain signal characteristics in familiarity category. Familiarity is a state when human recognize something. This research is using secondary data taken from DEAP: A Database for Emotion Analysis using Physiological Signals. Data taken from deap is the amount of 32 and has been through several pre-processing methods, so data can go straight to be processed using Hjorth Descriptor as the feature extraction method and Multilayer Perceptron (MLP) as the classifier method. The test is done with scenario where from 29 data used, 15 data is used as training data and 14 data is used as testing data. From the test result, the best accuracy is gained in balance class is 78.57% in trial 1, 2 and 27 with Hjorth Descriptor feature combinations of activity, mobility and complexity. Two hidden layers with 12 neurons in each hidden layer and epoch with the amount of 1000 is also used in MLP. Keywords: EEG, familiar, Hjorth Descriptor, Multilayer Perceptron
Prediksi Mata Uang Digital (bitcoin) Menggunakan Feed Forward Neural Network Ulky Parulian Wibowo; Jondri Jondri; Annisa Aditsania
eProceedings of Engineering Vol 6, No 1 (2019): April 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstrak Abstrak Bitcoin adalah mata uang kripto yang dikembangkan pada tahun 2019 oleh seorang ahli kriptografi dengan nama samaran Satoshi Nakamoto, karena Bitcoin memiliki jumlah yang terbatas sebanyak 21juta koin yang sifatnya mirip seperti emas yang jumlahnya terbatas. Bitcoin menggunakan teknologi blokchain yang artinya berjalan tanpa terikat oleh 1 pihak atau tanpa berpusat di satu titik yang artinya blokchain bersifat desentralisasi dan terdistribusi ke berbagai klien yang terhubung ke jaringan peer to peer blokchain. Adapun manfaat yang bisa diambil dari transaksi yang menggunakan Bitcoin, selain dari segi praktis dalam penggunaan juga kecepatan dalam bertransaksi, biaya transfer rendah sehingga membuat para pengguna dan komonitas Bitcoin itu sendiri memilih Bitcoin sebagai alat transaksi mereka. Metode yang digunakan dalam penelitian ini adalah Artificial Neural network (ANN) dengan model topologi Feed Forward Neural Network (FFNN). Dari 7,4 tahun data close price Bitcoin dengan struktur ANN terbaik 9-10-1 (7 variabel input, 1 hidden layer dengan 10 neuron dan 1 output) menghasilkan nilai root means square error (RMSE) 2350,0515. Kata kunci : Bitcoin, Artificial Neural Network(ANN) Feed Forward Neural Network (FFNN). Abstract Bitcoin is a crypto currency that was developed in 2019 by a cryptographer with a pseudonym Satoshi Nakamoto, because Bitcoin has a limited number of 21 million coins that are similar in appearance to a limited amount of gold. Bitcoin uses blockchain technology, which means it runs without being bound by 1 party or without centering on one point, which means the block is decentralized and distributed to various clients connected to the peer to peer network block chain. As for the benefits that can be taken from transactions that use Bitcoin, in addition to the practical aspects of the use of speed in transactions, the transfer fee is low so that the users and community of Bitcoin themselves choose Bitcoin as their transaction tool. The method used in this study is Artificial Neural network (ANN) with the Feed Forward Neural Network (FFNN) topology model. From 7,4 years of data close price Bitcoin with the best ANN structure 9-10-1 (7 input variables, 1 hidden layer with 10 neurons and 1 output) produces a root means square error (RMSE) 2350,0515. Keywords: Bitcoin, Artificial Neural Network (ANN), Feed Forward Neural Network (FFNN).
Reduksi Dimensi pada Optimasi Portofolio Mean-Variance Menggunakan Non-Negative Principal Component Analysis Elvina Oktavia; Deni Saepudin; Aniq Atiqi Rohmawati
eProceedings of Engineering Vol 6, No 2 (2019): Agustus 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Optimasi portofolio mean variance merupakan suatu metode dasar untuk menentukan alokasi investasi yang optimal ke berbagai saham. Implementasi metode reduksi dimensi Non-negative Principal Component Analysis sebagai alat pra-pemrosesan pada optimasi portofolio mean-variance, menghasilkan expected return sebesar 0,107% dan variance 0,020%, lebih baik dibanding menggunakan metode reduksi dimensi Principal Component Analysis yang menghasilkan expected return 0,103% dan variance 0,019% dan optimasi portofolio tanpa reduksi dimensi yang menghasilkan expected return 0,095% dan variance 0,010%.
Deteksi Zat Narkotika Berdasarkan Tekstur Menggunakan Metode Principal Component Analysis Dan Learning Vector Quantization Septian Eko Kuncahyono; Rita Magdalena; Sofia Sa’idah
eProceedings of Engineering Vol 6, No 2 (2019): Agustus 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstrak Narkotika adalah salah satu jenis narkoba yang berasal dari tanaman atau bukan tanaman, sintesis maupun semi sintesis. Narkotika sering digunakan didunia kedokteran untuk membius atau menghilangkan rasa sakit dan nyeri. Makin bertambahnya jenis – jenis napza yang beredar, aparat penegak hukum mengalami kesulitan pada saat proses penindakan pelanggaran kejahatan narkotika. Karena itu juga tidak semua petugas dilapangan mengetahui seluruh jenis narkotika yang beredar. Maka diperlukan sistem yang dapat mempermudah deteksi zat narkotika di sekitar kita. Pada tugas akhir ini dibuat sistem yang dapat mendeteksi dan mengklasifikasikan zat narkotika dengan pengolahan citra menggunakan metode ekstrasi ciri Principal Component Analysis (PCA) yang dapat mereduksi dimensi citra tanpa mengurangi karakteristik secara signifikan dan untuk klasifikasinya menggunakan Learning Vector Quantization (LVQ). Hasil yang didapat pada Tugas Akhir ini adalah aplikasi dengan menggunakan MATLAB yang dapat mengolah citra narkotika untuk mendeteksi jenis zat narkotika. Performansi yang dihasilkan oleh sistem yang dibuat yaitu akurasi sebesar 82% dan waktu komputasi 0.0179 dengan menggunakan parameter ciri statistik mean standard ddeviasi, size 128x128, komponen PCA 100, hidden size 30, learning rate 0.01 dan epoch 900. Kata Kunci : Zat narkotika, Principal Component Analysis (PCA), Learning Vector Quantization (LVQ). Abstract Narcotics are one of the types of drugs derived from plants or non-crops, synthesis and semi-synthesis. Narcotics are often used in the world of medicine to breed or relieve pain and pain. The increasing type of drugs in circulation, the law enforcement officers have difficulty in the process of enforcement of narcotic crimes violations. Cause that, not all officers in the field know all types of narcotics in circulation. Then, needed a system that can facilitate the detection of narcotic substances around us. In this final project, a system can be detected which can classify narcotics by image processing using the Principal Component Analysis (PCA) feature extraction method that can reduce the dimensions of the image without reducing its characteristics significantly and for its classification using Learning Vector Quantization (LVQ). The results obtained in this Final Project are applications using MATLAB which can process narcotics images to detect narcotics. The performance produced by the system is made, 82% accuracy and 0.0179 computation time using the mean standard deviasi statistical parameter, size 128x128, PCA 100 component, hidden size 30, learning rate 0.01 and epoch 900. Keywords: Narcotics, Principal Component Analysis (PCA), Learning Vector Quantization (LVQ).
Perancangan Tata Kelola Teknologi Informasi Sistem Pemerintahan Berbasis Elektronik Domain Edm Dan Mea Cobit 5 (studi Kasus : Dinas Komunikasi, Informatika Dan Statistik Kabupaten Bandung Barat) Widi Setia Cahyani; Irfan Darmawan; Rahmat Mulyana
eProceedings of Engineering Vol 6, No 2 (2019): Agustus 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstrak Pengembangan sistem informasi yang dilakukan dalam pemerintahan sebagian masih berupa sistem sektoral yang khusus sehingga tidak dapat digunakan secara bersama. Hal ini menyebabkan ketidakefektivan dalam pelaksanaan pemerintahan. Untuk mengatasi masalah ini, pemerintah berinisiatif mengembangkan sistem pemerintahan berbasis elektronik (SPBE) yang menyediakan keterpaduan penyelenggaraan pemerintahan. SPBE juga diimplementasikan di Kabupaten Bandung Barat (KBB) sebagai salah satu pemerintah kabupaten/kota. Namun demikian, KBB perlu melakukan pembenahan terhadap SPBE agar implementasi SPBE dapat dinilai matang dalam penilaian indeks SPBE. Untuk itu penyusunan tata kelola teknologi informasi pada Dinas Komunikasi, Informatika, dan Statistik Kabupaten Bandung Barat selaku pelaksana SPBE perlu dilakukan agar SPBE yang diimplementasikan dapat memenuhi target nilai indeks SPBE yang ditetapkan oleh Pemerintah . Penyusunan tata kelola TI yang dilakukan dalam penelitian ini menggunakan COBIT 5 sebagai kerangka kerja acuan. Tata kelola TI yang akan disusun hanya berfokus proses yang bersangkutan dengan domain Evaluate-Direct-Monitor (EDM) dan Monitor-Evaluate-Assess (MEA) pada COBIT 5 Kata Kunci : Tata Kelola Teknologi Informasi, Indeks SPBE, SPBE, COBIT 5, EDM. Abstract The development of information systems carried out in government is still a sectoral system so that it cannot be used together by other governmental organization. This causes ineffectiveness in the administration of government. To overcome this problem, the government took the initiative to develop an electronic-based government system (SPBE) that provides integrated governance. SPBE is also implemented in Kabupaten Bandung Barat (KBB) as one of the regency / city governments. However, KBB needs to reform the SPBE so that it can be considered as mature in its implementation based on SPBE index evaluation. For this reason, the information technology governance in Dinas Komunikasi, Informatika, dan Statistik Kabupaten Bandung Barat as the SPBE implementer needs to be done in order to improve SPBE index. The IT governance design carried out in this study uses COBIT 5 as a reference framework. The IT governance that will be compiled only focuses on the process concerned with the Evaluate-Direct-Monitor (EDM). Keywords: IT Governance, SPBE index, e-Government, COBIT 5, EDM.
Analisis Performansi Pengadaan Dan Pemasangan Node-b Dengan Menggunakan Metode Earned Value Management (evm) Fauzan Novendra Putra Yasya; Imam Haryono; Achmad Fuad Bay
eProceedings of Engineering Vol 6, No 2 (2019): Agustus 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstrak PT Dadali Citra Mandiri merupakan salah satu perusahaan yang bergerak di bidang penyedia layanan jasa jaringan telekomunikasi. PT Dadali Citra Mandiri sedang melaksanakan proyek pekerjaan pengadaan dan pemasangan node B batch 2 Telkom Regional III di Sumedang. Proyek tersebut merupakan proyek yang telah selesai dikerjakan oleh perusahaan. Perusahaan ingin mengetahui performansi proyek tersebut untuk dijadikan referensi pengerjaan proyek yang serupa. Berdasarkan hasil penelitian, performansi proyek sudah sangat baik karena baik nilai CPI maupun SPI pada hari terakhir berada pada nilai lebih dari 1. Hal ini menunjukkan bahwa proyek berjalan lebih cepat dari perencanaan (segi SPI) dan biaya yang dikeluarkan lebih rendah daripada biaya perencanaan (segi CPI). Mengacu kepada performance index monitoring, performansi proyek berada pada kuadran “good” yang juga menunjukkan keberhasilan proyek. Selanjutnya, berdasarkan perhitungan forecasting pada proyek, terdapat empat asumsi perhitungan untuk EAC dan keempat asumsi EAC pada hari ke-35 proyek berada di bawah nilai Budget at Completion (BAC) yang berarti biaya perkiraan yang harus dikeluarkan hingga proyek selesai berada di bawah budget. Kata kunci : Earned Value Management, Forecasting, Project, Network Diagram, Work Breakdown Structure PT Dadali Citra Mandiri is one of the companies engaged in telecommunications network service providers. PT Dadali Citra Mandiri is implementing a project for the procurement and installation of node B batch 2 Telkom Regional III in Sumedang. The project is a project that has been completed by the company. The company wants to know the performance of the project to be used as a reference for the construction of similar projects. Based on the results of the study, the project's performance was very good because both the CPI and SPI values on the last day were more than 1. This shows that the project runs faster than planning (SPI aspect) and the costs incurred are lower than planning costs (CPI). Referring to performance index monitoring, project performance is in the "good" quadrant which also shows the success of the project. Furthermore, based on forecasting calculations on the project, there are four assumptions calculated for EAC and all four assumptions of EAC on the 35th day of the project are below the value of the Budget at Completion (BAC) which means the estimated costs that must be incurred until the project is finished under the budget. Keywords: Earned Value Management, Forecasting, Project, Network Diagram, Work Breakdown Structure
Klasifikasi Katarak Menggunakan Metode Discrete Wavelet Transform (dwt) Dan Support Vector Machine (svm) Naufal Adi Gifran; Rita Magdalena; R. Yunendah Nur Fu'adah
eProceedings of Engineering Vol 6, No 2 (2019): Agustus 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstrak Katarak merupakan penyakit mata yang ditandai dengan mengeruhnya lensa mata, sehingga membuat penglihatan kabur. Seiring bertambahnya usia, protein pada lensa akan menggumpal dan perlahan-lahan membuat lensa keruh dan berkabut. Hal ini menyebabkan penglihatan menjadi kabur dan tidak jelas. Berdasarkan pada penjelasan di atas, maka penulis melakukan penelitian dengan menggunakan metode Discrete Wavelet Transform (DWT) dan klasifikasi Support Vector Machine (SVM) untuk merancang sistem klasifikasi katarak. Penelitian sebelumnya tentang klasifikasi katarak pernah dilakukan oleh Rais Zul Ihram pada tahun 2018 mendapatkan akurasi sebesar 93,3% dengan menggunakan metode GLCM dengan klasifikasi yang digunakan adalah SVM. Penelitian serupa dilakukan oleh Rizkia Dwi Auliannisa pada tahun 2017 tentang deteksi katarak menggunakan metode Transformasi Hough berbasis Android dengan menggunakan pengklasifikasian K-NN dan mencapai akurasi lebih dari 80%. Dari hasil pengujian diperoleh akurasi terbaik dari klasifikasi katarak sebesar 80%. Akurasi tersebut didapatkan dari pengujian 90 citra mata yang memiliki ukuran 512x512 piksel, pada tahap ekstrasi ciri digunakan subband filter LH pada metode Discrete Wavelet Transform (DWT). Digunakan kombinasi enam ciri statistik yaitu Mean, standar deviasi, skewness, kurtosis, entropy, variance. Pada tahap klasifikasi digunakan metode Support Vector Machine (SVM) dengan kernel gaussian, dan pembagian multikelas OneAgainst-All (OAA). Kata Kunci : Katarak, Discrete Wavelet Transform (DWT), Support Vector Machine (SVM) Abstract Cataract is an eye disease characterized by the clouding of the lens of the eye, which makes vision blurry. As we get older, the protein in the lens will clot and slowly make the lens cloudy and foggy. This causes vision to be blurred and unclear. Based on the explanation above, the authors conducted a study using the Discrete Wavelet Transform (DWT) method and the Support Vector Machine (SVM) classification to design a cataract classification system. Previous research on the classification of cataracts was done by Rais Zul Ihram in 2018 to get an accuracy of 93.3% using the GLCM method with the classification used was SVM. A similar study was conducted by Rizkia Dwi Auliannisa in 2017 on cataract detection using the Android-based Hough Transform method using K-NN classification and achieving an accuracy of more than 80%. From the test results obtained the best accuracy of cataract classification by 80%. The accuracy is obtained from testing 90 eye images that have a size of 512x512 pixels, at the feature extraction stage the LH subband filter is used in the Discrete Wavelet Transform (DWT) method. A combination of six statistical features is used, namely Mean, standard deviation, skewness, kurtosis, entropy, variance. At the classification stage, the Support Vector Machine (SVM) method is used with the Gaussian kernel, and the One-Against-All (OAA) multiclass division. Keywords: Cataract, Discrete Wavelet Transform (DWT), Support Vector Machine (SVM)
Implementasi Webqual 4.0 Untuk Pembangunan Aplikasi Pengukuran Kualitas Website (webqtools) Ayu Nurlatifah; Sri Widowati; Rosa Reska Riskiana
eProceedings of Engineering Vol 6, No 2 (2019): Agustus 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstrak Sebuah website menjadi salah satu sarana penyedia layanan informasi dimana manfaat dari websitesendiri yaitu dapat digunakan sebagai media yang efektif dan efesien karena mampu digunakan oleh userdimanapun dan kapanpun. Website sendiri dalam pengelolaan informasi maupun layanan dapat diperolehmelalui jenis websitenya. Jenis-jenis website berdsarkan fungsinya yakni seperti : Company Profile, EGoverment,eCommerce,Archive,PortalBeritadanInformasi,danBlog.Berdasarkanpemanfaatanlayanandaninformasiyangdimuatdalamsuatuwebsitetentuharusmemperhatikankualitasnyaterhadapuseryangmengakseswebsitetersebut.Pengalamanuserdalammelakukanaksessuatuwebsitesangatberpengaruhterhadappenilaiankualitasnya.Olehkarenaitupeneltianinimembahastentanganalisiskualitaslayananwebsitemenggunakan metode WebQual 4.0 untuk mengukur penilaian dari segi user denganmemperhatikan dimensi usability quality, information quality, dan service interaction quality. Website yangdilakukan pengujian yakni jenis website E-Goverment dan eCommerce. Hasil analisis dan evaluasi daripenelitian ini yang nantinya akan menjadi suatu rekomendasi untuk pengembangan kualitas layananwebsite yang lebih baik.Kata kunci : Website, Webqual 4.0, Usability Quality, Information Quality, Service Interaction Quality,WebQTools.Abstract A website is one of the means of an information service provider where the benefits of the website itselfcan be used as an effective and efficient media because it can be used by users wherever and whenever. Thewebsite itself in managing information and services can be obtained through the type of website. Types ofwebsites based on their functions such as Company Profile, E-Government, eCommerce, Archive, News andInformation Portal, and Blog. Based on the utilization of services and information contained in a website, ofcourse, must pay attention to the quality of the users who access the website. The user experience in accessinga website is very influential in the quality assessment. Therefore this research discusses the analysis of thequality of website services using the WebQual 4.0 method to measure the assessment in terms of the user bypaying attention to the dimensions of usability quality, information quality, and service interaction quality.Website testing is the type of E-Government and eCommerce website. The results of the analysis andevaluation of this study will later become a recommendation for the development of better website servicequality.Keywords: Website, Webqual 4.0, Usability Quality, Information Quality, Service Interaction Quality,WebQTools.
Perancangan Jaringan Komunikasi Lte Penumpang Kereta Cepat 160 Km/jam Jakarta-surabaya Jalur Cepu-surabaya Tomy Irawan; Erna Sri Sugesti; Rina Pudji Astuti
eProceedings of Engineering Vol 6, No 2 (2019): Agustus 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstrak Kecepatan kereta menimbulkan fluktuasi level daya terima penumpang kereta dalam sistem komunikasi. Salah satu penyebab utama adalah terdapat area cakupan yang buruk. Efek dari hal tersebut menimbulkan kualitas jaringan komunikasi menurun. Tugas akhir ini merancang jaringan LTE untuk penumpang pada kecepatan 160 km/jam dari stasiun Cepu ke stasiun Pasar Turi Surabaya dengan frekuensi 900 MHz. Perancangan jaringan LTE dengan overlapping coverage merupakan solusi dari masalah jaringan pada kereta cepat. Penggunaan Remote Radio Unit (RRU) dengan ketinggian penempatan sel berfokus untuk mendukung jaringan rel kereta. Site Existing sekitar rel kereta digunakan untuk penempatan RRU. Rancangan yang dibuat memperhatikan kecepatan user, delay trafik, serta overlapping coverage untuk handover (HO). Hasil simulasi LTE-Sim dan perhitungan diperoleh delay pada kecepatan 160 km/jam sebesar 0,01850966 detik. Overlapping coverage setiap RRU sebesar 1,7 km untuk HO dengan dua sel mencakup rata-rata 8,5 km panjang rel kereta. Dibutuhkan tujuh RRU diletakkan di site existing dan 12 RRU tambahan untuk rel kereta sejauh 141 km. Simulasi dari perancangan diperoleh RSRP yakni -63,92 dBm dengan 97,1 % area berhasil tercakup dan nilai rata-rata SINR sebesar 10,77 dB. Kata Kunci : LTE, RRU, delay, handover, macro cell, overlapping coverage Abstract Train speed mobility affect to fluctuations in the train passenger receiving power level signal in the communication system. One of the main causes is there is a poor coverage area. The effect of this causes made bad network quality for communication. This final project designed an LTE network for passengers at a speed of 160 km/h from Cepu station to Pasar Turi Surabaya station with a frequency of 900 MHz. The design of the LTE network with overlapping coverage is a solution to network problems on fast trains. The use of the Remote Radio Unit (RRU) with cell placement height focuses on supporting the railroad network. Existing sites around the railroad tracks are used for RRU’s cell placements. The design considered about user speed, traffic delay, and overlapping coverage for handovers (HO). The simulation results of LTE-Sim and calculations obtained delay at a speed of 160 km/h at 0,01850966 seconds. Each RRU's overlapping coverage of 1,7 km for HO with two cells covers an average of 8,5 km of railroad length. It took seven RRUs to be placed on the existing site and 12 RRUs to add 141 km of railroads. The simulation of the design obtained RSRP value is -63,92 dBm with 97,1% of the area successfully covered and the SINR average value of 10,77 dB. Keywords: LTE, RRU, delay, handover, macro cell, overlapping coverage
Analisa Pengaruh Intensitas Cahaya Lampu Light Emitting Diode Pada Pertumbuhan Tanaman Bayam (amaranthus Tricolor) Di Dalam Ruangan Nanda Salsabila Nadhifa; M. Ramdlan Kirom; Endang Rosdiana
eProceedings of Engineering Vol 6, No 2 (2019): Agustus 2019
Publisher : eProceedings of Engineering

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

AbstrakBayam merupakan tanaman hijau yang ditanam untuk dikonsumsi daunnya. Di beberapa negaraberkembang, bayam memiliki banyak peminat karena terdapat banyak kandungan gizi yang baik untuktubuh. Akan tetapi , keterbatasan jumlah lahan dan cuaca yang tidak menentu menjadi kendala dalammemenuhi tingkat kebutuhan bayam. Solusi untuk mengatasi permasalahan ini adalah dengan menanamtanaman bayam di dalam ruang dengan lampu LED sebagai alternatif pengganti cahaya matahari agartanaman tetap bisa melakukan proses fotosintesis. Penelitian ini bertujuan untuk mengetahui pengaruhdari perbedaan intensitas cahaya lampu yang diterima oleh tanaman pada pertumbuhan tanaman bayamdi dalam ruangan. Penelitian ini, dilakukan di dalam 10 ruang penanaman dengan intensitas cahaya yang berbeda-bedamenggunakan lampu LED berwarna merah dan biru. Proses pengamatan harian meliputi pengamatanintensitas cahaya LED, kelembaban udara, suhu ruang, tinggi tanaman, panjang daun dan jumlah daun.Hasil penelitian menunjukkan bahwa jika menggunakan penggabungan cahaya merah dan biru, kualitastanaman lebih baik daripada menggunakan cahaya merah dan biru secara terpisah dan intensitas optimalyang dapat digunakan yaitu 68 Lux dengan rentang hidup 22 hari.Kata Kunci: bayam, LED, intensitasAbstract Spinach is greenery planted for the consumption of the leaves. In some developing countries, spinach hasmany enthusiasts because there is a lot of good nutrient for the body. However, the limitations of land anderratic weather are becoming constraints in meeting the needs of spinach. The solution to overcome thisproblem is to plant spinach plants in the room with LED lights as an alternative to sunlight so that plantscan still carry out a photosynthesis process. This research aims to determine the effect of differences in lightintensity received by plants on the growth of spinach plants in the room. This research was carried out in 10 planting rooms with different light intensities using red and blue LEDlights. Daily observation process includes observation of LED light intensity, humidity, room temperature,plant height, leaf length and the number of leaves. The results showed that when using a combination of redand blue light, the quality of the plant is better than using red and blue light separately and the optimalintensity that can be used is 68 Lux with a life span of 22 days.Keywords: spinach, LED, intensity

Filter by Year

2014 2025


Filter By Issues
All Issue Vol. 12 No. 6 (2025): Desember 2025 Vol. 12 No. 5 (2025): Oktober 2025 Vol. 12 No. 4 (2025): Agustus 2025 Vol. 12 No. 3 (2025): Juni 2025 Vol. 12 No. 2 (2025): April 2025 Vol. 12 No. 1 (2025): Februari 2025 Vol. 11 No. 6 (2024): Desember 2024 Vol. 11 No. 5 (2024): Oktober 2024 Vol. 11 No. 4 (2024): Agustus 2024 Vol. 11 No. 3 (2024): Juni 2024 Vol. 11 No. 2 (2024): April 2024 Vol. 11 No. 1 (2024): Februari 2024 Vol. 10 No. 6 (2023): Desember 2023 Vol 10, No 5 (2023): Oktober 2023 Vol. 10 No. 5 (2023): Oktober 2023 Vol. 10 No. 4 (2023): Agustus 2023 Vol 10, No 3 (2023): Juni 2023 Vol. 10 No. 3 (2023): Juni 2023 Vol. 10 No. 2 (2023): April 2023 Vol 10, No 2 (2023): April 2023 Vol. 10 No. 1 (2023): Februari 2023 Vol 9, No 6 (2022): Desember 2022 Vol. 9 No. 5 (2022): Oktober 2022 Vol 9, No 5 (2022): Oktober 2022 Vol. 9 No. 4 (2022): Agustus 2022 Vol 9, No 4 (2022): Agustus 2022 Vol 9, No 3 (2022): Juni 2022 Vol 9, No 2 (2022): April 2022 Vol 9, No 1 (2022): Februari 2022 Vol 8, No 6 (2021): Desember 2021 Vol 8, No 5 (2021): Oktober 2021 Vol. 8 No. 5 (2021): Oktober 2021 Vol 8, No 4 (2021): Agustus 2021 Vol 8, No 3 (2021): Juni 2021 Vol. 8 No. 2 (2021): April 2021 Vol 8, No 2 (2021): April 2021 Vol 8, No 1 (2021): Februari 2021 Vol 7, No 3 (2020): Desember 2020 Vol 7, No 2 (2020): Agustus 2020 Vol 7, No 1 (2020): April 2020 Vol 6, No 3 (2019): Desember 2019 Vol 6, No 2 (2019): Agustus 2019 Vol 6, No 1 (2019): April 2019 Vol 5, No 3 (2018): Desember 2018 Vol 5, No 2 (2018): Agustus 2018 Vol 5, No 1 (2018): April 2018 Vol 4, No 3 (2017): Desember, 2017 Vol 4, No 2 (2017): Agustus, 2017 Vol 4, No 1 (2017): April, 2017 Vol 3, No 3 (2016): Desember, 2016 Vol 3, No 2 (2016): Agustus, 2016 Vol 3, No 1 (2016): April, 2016 Vol 2, No 3 (2015): Desember, 2015 Vol 2, No 2 (2015): Agustus, 2015 Vol 2, No 1 (2015): April, 2015 Vol 1, No 1 (2014): Desember, 2014 More Issue