cover
Contact Name
Aulia Qisthi
Contact Email
auliaqisthi@ui.ac.id
Phone
+6285860672438
Journal Mail Official
syntaxliterateofficial@gmail.com
Editorial Address
Greenland Sedang Residence E6 Sumber Cirebon, West Java, Indonesia
Location
Kota cirebon,
Jawa barat
INDONESIA
Syntax Literate: Jurnal Ilmiah Indonesia
ISSN : 25410849     EISSN : 25410849     DOI : -
Syntax Literate: Jurnal Ilmiah Indonesia is a peer-reviewed scientific journal that publishes original research and critical studies in various fields of science, including education, social sciences, humanities, economics, and engineering. The journal aims to provide a platform for researchers, academics, and practitioners to disseminate their findings and insights for the advancement of knowledge and practice in Indonesia and beyond.
Articles 6,396 Documents
Hubungan Kunjungan Antenatal Care Dengan Tingkat Pengetahuan Tentang Preeklamsia Pada Ibu Hamil Di Puskesmas Sedong Aprila, Bela; Wirandoko, Ignatius Hapsoro; Suroso, Triono Adi
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i10.61685

Abstract

Latar Belakang : Preeklamsia merupakan salah satu penyebab utama kematian ibu dan janin di Indonesia, ditandai dengan hipertensi dan proteinuria setelah usia kehamilan 20 minggu. Kurangnya pengetahuan ibu hamil mengenai preeklamsia berkontribusi terhadap keterlambatan deteksi dan penanganan kondisi ini. Kunjungan antenatal care (ANC) secara teratur merupakan upaya penting dalam meningkatkan pengetahuan ibu hamil mengenai tanda bahaya kehamilan, termasuk preeklamsia. Berdasarkan data WHO tahun 2020, preeklamsia menyumbang sekitar 25% dari penyebab kematian ibu di dunia, dan di Indonesia tercatat 412 kasus kematian ibu akibat preeklamsia pada tahun 2023. Prevalensi hipertensi dalam kehamilan di Jawa Barat mencapai 10,57%, tertinggi di Indonesia. Tujuan : Menganalisis hubungan kunjungan antenatal care dengan tingkat pengetahuan tentang preeklamsia pada ibu hamil di puskesmas sedong. Metode : Penelitian ini merupakan penelitian observasional analitik dengan pendekatan cross sectional. Teknik pengambilan sampel menggunakan accidental sampling dengan jumlah sampel sebanyak 97 ibu hamil. Instrumen yang digunakan adalah kuesioner terstruktur yang telah diuji validitas dan reliabilitasnya. Analisis data dilakukan menggunakan uji Spearman. Hasil : Terdapat hubungan yang signifikan antara hubungan kunjungan antental care dengan tingkat pengetahuan tentang preeklamsia pada ibu hamil (p=0,006). Kesimpulan: Penelitian menunjukkan adanya hubungan signifikan antara kunjungan antenatal care dan pengetahuan tentang preeklamsia di Puskesmas Sedong. Ibu hamil yang rutin melakukan kunjungan antenatal cenderung memiliki pemahaman yang lebih baik mengenai preeklamsia. Hal ini menyimpulkan bahwa pentingnya peningkatan akses dan kepatuhan terhadap kunjungan ANC guna meningkatkan pengetahuan serta pencegahan terhadap preeklamsia.
Karakteristik Dan Prevalensi Konjungtivitis Vernal Di RSUD Waled Tahun 2023 Nurrohman, Muhammad Rizky; Akturusiano, Binto; Hapsoro Wirandoko, Ignatius
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i10.61686

Abstract

Latar Belakang : Konjungtivitis vernal merupakan peradangan alergi kronik dan berulang pada konjungtiva, yang lebih sering terjadi pada anak laki-laki usia 5–15 tahun, terutama di daerah tropis. Penyakit ini dipicu oleh paparan alergen seperti debu dan sinar matahari, serta dapat menyebabkan komplikasi pada kornea jika tidak ditangani dengan tepat. Tujuan : Penelitian ini bertujuan untuk mengetahui karakteristik dan prevalensi konjungtivitis vernal di RSUD Waled tahun 2023. Metode : Penelitian ini merupakan studi deskriptif retrospektif dengan pendekatan kualitatif menggunakan data sekunder dari rekam medis pasien konjungtivitis vernal di RSUD Waled selama tahun 2023. Teknik pengambilan sampel menggunakan total sampling dengan jumlah sampel sebanyak 57 pasien. Hasil : Sebagian besar pasien berasal dari kelompok usia 5–11 tahun (66,7%) dan berjenis kelamin laki-laki (66,7%). Faktor risiko utama adalah paparan debu (61,4%), dengan gejala terbanyak berupa mata merah (20,5%) dan mata gatal (19,3%). Komplikasi paling banyak berupa keratokonjungtivitis vernal (12,3%). Prevalensi kasus yang ditemukan selama satu tahun adalah 65 pasien. Simpulan : Konjungtivitis vernal di RSUD Waled tahun 2023 paling banyak terjadi pada anak laki-laki usia sekolah dasar dengan paparan utama berupa debu dan gejala khas seperti mata merah dan gatal.
Efek Pemberian Ekstrak Kulit Buah Mangga Arum Manis (Mangifera Indica) Terhadap Gambaran Histopatologi Tikus Wistar Jantan Obesitas Yang Diinduksi High Lipid Diet Dan Aloksan Khoven, Kimi; Theresia, Yohani; Anggraini , Tri Lidya
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i9.61691

Abstract

Obesity is a global problem that can cause pancreatic damage through increased oxidative stress. Mango peel contains bioactive compounds such as flavonoids, tannins, steroids, terpenoids, alkaloids, saponins, and polyphenols that have antioxidant functions. This study aims to evaluate the effect of giving mango arum manis fruit peel extract on the histopathology of pancreatic tissue and blood sugar levels of obese male Wistar rats induced by high lipid diet and alloxan. This study used a post-test only control group design which was divided into a positive group given pioglitazone 3 mg/kg BW, a group given 30 mg/kg BW extract, 60 mg/kg BW extract, and 120 mg/kg BW sweet mango arum fruit peel extract. The results of histopathological examination of pancreatic tissue showed that in all groups there was pancreatic damage with a score of 3, so it did not show significant differences. However, in the examination of blood sugar levels, there were significant differences before and after the administration of sweet mango arum fruit peel extract, which showed the most significant results were the administration of sweet mango arum fruit peel extract at a dose of 30 mg / kg BW and 120 mg / kg BW.
Analisis Efektivitas Logistic Regression dalam Identifikasi Serangan DDoS pada Jaringan IoT Berbasis Dataset IoT-DIAD2024 Laufra, Lukas Febrian; Somantri
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i9.61692

Abstract

Penelitian ini mengevaluasi efektivitas Logistic Regression dalam mendeteksi serangan Distributed Denial of Service (DDoS) pada jaringan Internet of Things (IoT) menggunakan dataset IoT-DIAD2024. Dataset ini menggabungkan tiga jenis serangan (HTTP Flood, TCP Flood, dan UDP Flood) dari file CSV terpisah, dengan fitur seperti inter_arrival_time, jitter, dan User Agent. Dua model dikembangkan: Model 1 untuk memprediksi jenis serangan, dan Model 2 untuk mengklasifikasikan tingkat keparahan (High, Medium, Low). Pipeline prapemrosesan meliputi SimpleImputer untuk menangani nilai hilang dan StandardScaler untuk normalisasi fitur. Kedua model mencapai akurasi 0,99, dengan matriks konfusi menunjukkan kesalahan minimal, seperti 162 prediksi HTTP Flood sebagai UDP Flood. Ketiadaan data normal dalam dataset dapat menyebabkan bias, sehingga integrasi data normal direkomendasikan untuk validasi lebih lanjut. Penelitian ini mendukung pengembangan sistem keamanan IoT yang lebih robust dan memenuhi tugas akademik Jalur Penelitian Semester 6 di Universitas Nusa Putra pada Juli 2025.
Pentingnya Aspek Peran Kesadaran Terhadap Pengungkapan Environmental, Social, And Governance (ESG) Di Indonesia: Literature Review Carmelita, Angelique Diva
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i9.61695

Abstract

Penelitian ini mengjabarkan dampak bounded awareness dan framing effect pada aspek kesadaran terhadap pengungkapan Environmental, Social, and Governance (ESG) di perusahaan Indonesia. Melalui kajian literature ini, penelitian ini mengidentifikasi tantangan bounded awareness, seperti ketebatasan informasi dan bias kognitif, serta pengaruh framing effect pada pengambilan keputusan terkait ESG. Strategi untuk mengatasi tantangan ini meliputi peningkatan mindfulness, penggunaan sistem informasi yang efektif, audit secara berkala, dan penyajian informasi yang seimbang. Temuan menunjukkan bahwa dengan strategi yang tepat, perusahaan dapat meningkatkan transparansi dan akuntabilitas ESG, memperkuat reputasi, dan kinerja jangka panjang (going concern) mereka.
Pencarian Kandidat Vaksin Tbc Dari Epitope Protein Agj16802.1 (Virulence Factor Mce Family Protein [Mycobacterium Tuberculosis Str. Beijing/Nitr203]) Prasetyaningtyas, Herawati Dwi; Wahjudi, Mariana; Yulanda Antonius
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i9.61696

Abstract

In 2022, the burden of TB in the world was 10,556,328. The incidence of tuberculosis in Indonesia in 2021 was 969,000. The increase in TB incidence in 2021 was 18%. WHO has set a global target and milestone to reduce the incidence of TB by the end of 2030, as well as the Indonesian Ministry of Health. TB can be prevented with the BCG vaccine. BCG avoids phagosome maturation, autophagy, and reduces MHC-II expression of APCs that affect T cell activation by triggering an IgM antibody response, class-switched IgG, to specific proteins ESAT6 and CFP10. Protein subunit vaccines are an option to induce an immune response. Antigens recognized by cells during latent infection and involved in immunological evasion mechanisms or the emergence of CD4+ and CD8+ specific T cells are potential targets. One of these approaches is the incorporation of molecules capable of interacting with PRRs to recognize PAMPs. TLR is found in APC. The recognition of PAMPs by TLRs can result in the expression of co-stimulation molecules as well as the expression of proinflammatory cytokines, TNF-α, COX-2, and interferon associated with the development of adaptive immune responses by B and T lymphocytes. This project aims to determine the possibility of epitopes from protein AGJ68032.1 to be TB vaccine by comparing the results of docking epitope-TLR2 with TLR2-ESAT6. The material used in this project is protein AGJ68032.1 virulence factor Mce family protein [Mycobacterium tuberculosis str. Beijing/NITR203]. The steps were carried out: search for fasta AGJ68032.1, protein similarity test against Mycobacterium tuberculosis protein, determine the location of proteins, search for protein characteristics, find the location of all proteins, search for Bcell epitope, search for Tcell epitope (MHC class 2), epitope similarity test from MHC class 2 with homo sapiens, antigenecity test, allergenicity test, search for the 3D shape of each epitope-TLR2-ESAT-6, molecular docking TLR2 with ESAT-6 and TLR 2 with epitope and comparing the result data Docking. Epitope protein AGJ68031.1 (FAGDDVRIRGVPVGKIVKIEPQPLRAKVSFW) has high potential to be used as a tuberculosis vaccine candidate because the docking results with TLR have a HADDOCK score of -152.5 +/- 7.3 and an RSMD value that is close to the HADDOCK score and the RSMD TLR2 value with ESAT6.
Pengaruh Pendidikan Karakter Terhadap Sikap Patuh Dan Disiplin Siswa Di SMP Maitreyawira Di Provinsi Riau Susi, Susi; Darmika, Ida Bagus; Wong, Mettadewi
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i10.61702

Abstract

Hasil survey pra penelitian peneliti berdasarkan hasil wawancara dengan salah satu guru, mengatakan bahwa sikap dan perilaku yang dimiliki siswa yang kurang sesuai dengan norma dalam agama Budha. Fenomena ini menunjukkan bahwa belum tercapainya pendidikan karakter yang diberikan guru pada siswa dan masih rendahnya sikap patuh dan perilaku disiplin siswa. Penelitian ini bertujuan Untuk menganalisis pengaruh pendidikan karakter terhadap patuh dan perilaku disiplin siswa SMP Maitreyawira Dumai dan SMP Metta Maitreya Pekan Baru. Penelitian ini adalah jenis penelitian kuantitatif. Sampel penelitian seluruh siswa SMP Maitreyawira Dumai dan SMP Metta Maitreya Pekan Baru yang berjumlah 124 orang. Teknik pengambilan sampel dalam penelitian menggunakan accidental sampling. Pengujian hipotesis dan teknik analisis data Regresi Linear Berganda. Hasil penelitian menunjukkan terdapat pengaruh positif dan signifikan antara pendidikan karakter terhadap perilaku disiplin, maka bila pendidikan karakter siswa ditingkatkan, maka perilaku disiplin siswa juga semakin meningkat searah dengan peningkatan pendidikan karakter dan terdapat pengaruh positif dan signifikan antara sikap patuh terhadap perilaku disiplin, maka bila sikap patuh siswa ditingkatkan, maka perilaku disiplin siswa juga semakin meningkat searah dengan peningkatan sikap patuh serta terdapat pengaruh pendidikan karakter dan sikap patuh berpengaruh terhadap perilaku disiplin pada siswa SMP Maitreyawira Dumai dan SMP Metta Maitreya Pekan Baru dengan presentase sumbangan pengaruh variabel pendidikan karakter dan sikap patuh terhadap perilaku disiplin sebesar 57.1% dan sisanya 42.9% dipengaruhi atau dijelaskan oleh variabel lain yang tidak terdapat dalam model atau diluar dari penelitian ini.
Analisis Strategi Pemasaran Sales Generalis Produktif Dalam Penyaluran Kredit Mikro PT. Bank Mandiri KCP Kudus Alun Alun Anwar, Rahita Nadya; H, AG. Sunarno; Sutono, Sutono
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i9.61703

Abstract

This study analyzes the marketing strategies of Productive Generalist Sales (SGP) in microcredit distribution at PT Bank Mandiri KCP Kudus Alun-Alun. The study is based on Bank Mandiri’s strategic role as a state-owned bank distributing KUR and KUM loans to MSMEs, yet experiencing a decline in borrowers over the past five years. Using a qualitative descriptive method through interviews, observations, and documentation, the research employs SWOT analysis to identify internal and external factors affecting SGP performance. Findings show strengths in competitive credit products, experienced SGP staff, and strategic branch locations, while weaknesses include suboptimal digital promotion, inefficient outreach patterns, and relatively long disbursement processes. Opportunities come from government support, MSME market potential, and financial technology development, whereas threats include competition from fintech and rural banks, economic instability, and shifting customer preferences toward faster services. The resulting strategies include optimizing networks and flagship products (SO), strengthening brand image and fast services (ST), transforming promotions into digital platforms (WO), and enhancing SGP competence with product diversification (WT). The study concludes that the success of microcredit marketing strategies depends on leveraging internal strengths, external opportunities, technology-based innovations, and human resource capacity building. These findings contribute theoretically to SWOT-based microcredit marketing strategy models and provide managerial implications for improving Bank Mandiri’s credit distribution performance.
The Impact of Extended Work Availability on Turnover Intention Among Generation Z in Indonesia Mantana, Immanuel; Kurniadi, Nicholas; Astuti, Niken Dwi; Suryaatmaja, Kevin
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i10.61724

Abstract

This research aims to examine the relationship between Work-Related Extended Availability (WREA) and Perceived Organizational Support (POS) on Turnover Intention (TI) among Generation Z employees in Indonesia. The study also analyzes the mediating roles of Emotional Exhaustion (EMO) and Work Engagement (WE), as well as the moderating roles of POS and WREA in these relationships. A quantitative approach was employed through an online survey distributed via Google Forms. Data were collected using purposive sampling from 310 Generation Z employees working across various industrial sectors in Indonesia. Data analysis was conducted using Partial Least Squares-Structural Equation Modeling (PLS-SEM) with SmartPLS version 4 software. The findings indicate that WREA significantly increases EMO, which subsequently raises TI among Generation Z employees in Indonesia. Conversely, POS enhances WE and indirectly reduces TI. The moderating effect of WREA on the POS–WE relationship was significant, whereas the moderating effect of POS on the WREA–EMO relationship was not supported. This study extends the application of the Job Demands-Resources (JD-R) model within the context of Generation Z employees in Indonesia by simultaneously integrating mediation and moderation effects. Practically, organizations should limit WREA and strengthen support tailored to the digital needs of Gen Z employees to prevent emotional exhaustion and reduce turnover intention.
Hubungan Derajat Miopia dengan Tekanan Intraokuler pada Pasien di RS Mata Prima Vision Medan Singh, Jak Mohan; Yumardika, Deza; Suandy , Suandy
Syntax Literate Jurnal Ilmiah Indonesia
Publisher : Syntax Corporation

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.36418/syntax-literate.v10i9.61731

Abstract

Myopia is one of the most common refractive errors found in the community and has become a major cause of visual impairment and blindness worldwide. The degree of myopia may influence intraocular pressure (IOP), which is a major risk factor for glaucoma. This study aimed to determine the relationship between the degree of myopia and intraocular pressure among patients at Prima Vision Eye Hospital Medan. This research employed an analytical method with a cross-sectional design. The study sample consisted of 48 patients diagnosed with myopia who met the inclusion criteria. The degree of myopia was categorized based on refraction examination results, while IOP was measured using non-contact tonometry. Data were analyzed using the Chi-Square test. The results showed that most respondents were aged 21–30 years (39.6%) and the majority were female (58.3%). Most patients had moderate myopia (47.9%). Statistical analysis revealed a significant relationship between the degree of myopia and intraocular pressure (p < 0.05). In conclusion, there is a significant correlation between the degree of myopia and intraocular pressure among patients at Prima Vision Eye Hospital Medan. It is recommended that patients with high myopia undergo regular eye examinations for early detection of increased IOP and glaucoma risk.

Filter by Year

2016 2026