cover
Contact Name
Ivandini Tribidasari A.
Contact Email
ivandini.tri@sci.ui.ac.id
Phone
+622129120943
Journal Mail Official
editor_mss@ui.ac.id
Editorial Address
Directorate of Research and Community Engagement UNIVERSITAS INDONESIA UI Campus, Depok 16424 Indonesia
Location
Kota depok,
Jawa barat
INDONESIA
Makara Journal of Science
Published by Universitas Indonesia
ISSN : 23391995     EISSN : 23560851     DOI : https://doi.org/10.7454/mss
Core Subject :
Makara Journal of Science publishes original research or theoretical papers, notes, and minireviews on new knowledge and research or research applications on current issues in basic sciences, namely: Material Sciences (including: physics, biology, and chemistry); Biochemistry, Genetics, and Molecular Biology (including: microbiology, physiology, ecology, taxonomy and evolution); and Biotechnology.
Arjuna Subject : -
Articles 910 Documents
PENGARUH PENYUNTIKAN DOSIS MINIMAL DEPOT MEDROKSIPROGESTERON ASETAT (DMPA) TERHADAP BERAT BADAN DAN KIMIA DARAH TIKUS JANTAN GALUR SPRAGUE-DAWLEY Yurnadi, Yurnadi; Suryandari, Dwi Anita; Moeloek, Nukman
Makara Journal of Science Vol. 13, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Effect of Injection Minimal Dosages of Depot Medroxyprogesterone acetate (DMPA) to Body Weight and Blood Chemistry Male Rat Strain Sprague-Dawley. Many family planning program focus more on men. Until now, vasectomy has been the commonly used method for male contraception. However, this method creates inconvenience such as irreversibility and psychological problems. One of the alternatives contraception is the combination of depot medroxyprogesterone acetate (DMPA) and androgen. The minimum dosage of DMPA could suppress testosterone level that leads to reduced spermatogenesis and sperm viability. Nevertheless, until now it is not known whether minimum dosages of DMPA have an effect to body weight and blood chemistry. Therefore, this research aimed at determinate the effect of minimal dosages of DMPA to body mass and blood chemistry using male rats (Rattus norvegicus L.) strain Sprague-Dawley as model. This research using completely randomized design, unequal size sample, castration treatments and several doses DMPA (1.25, 0.625, and 0.313 milligram). Injecting of DMPA conducted intramuscularly on week 0 and week 12. Normality/homogeneity Data normality were analyzed before ANOVA test. Then, abnormal data were tested using Kruskal-Wallis test. The result shows that injection of DMPA in various doses do not have an effect on body weight and blood chemistry such as erytrocytes, haemoglobin, hematocrite, HDL, LDL, total cholesterol, SGOT, SGPT and triglyseride) (p>0,05). Furthermore, it is concluded that that no effect of minimal dosages of DMPA to body mass and blood chemistry of rat.
PEMBERIAN AKAR PASAK BUMI (Eurycoma longifolia Jack.) PADA INDUK LAKTASI UNTUK MENINGKATKAN BOBOT BADAN ANAK MENCIT Panjaitan, Ruqiah Ganda Putri; Jayuska, Afghani; Harahap, Zulfan; Zakiah, Zulfa
Makara Journal of Science Vol. 13, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

The Effect of Administration of Pasak Bumi (Eurycoma longifolia Jack.) Roots on Lactating Mice to Increase Body Weight Pups. The roots of Eurycoma longifolia Jack have been used as a traditional medicine for aprodisiac. The effects of the root extract of E. longifolia Jack were studied on lactating mice. Each mice was administered metanol extract and its derived fractions at dose 500 mg/kg rat body weight for 21 consecutive days in lactation period. Control positive group received Moloco+B12 at dose 0,13 g/kg rat body weight, negative control (placebo) group received 2 ml/kg rat body weight of aquadest daily and normal control group. No differences between normal control, negative control, positive control, and metanol extract and its derived fractions. The administration methanol-water fraction to lactating mice increasing body weight mice pups similar to Moloco+B12.
CuInSe2 THIN FILM FOR SOLAR CELL BY FLASH EVAPORATION Soepardjo, A H
Makara Journal of Science Vol. 13, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Deposition of thin films for material solar cell CuInSe2 are relatively simple. In this research mainly focused on the use of flash evaporation method, and the material created can then be characterized by optical and electrical properties. The optical characterization is done by X-ray Diffraction (XRD), Energy Dispersive Spectroscopy (EDS), and transmission and reflection by UV-VIS spectrophotometry. Electrical characterization is done by utilizing the Hall effect equipment. From these characterization, the atomic structure, absorption coefficient, energy gap, material type, composition of each elements and the mobility of CuInSe2 can be measured and determined. During process evaporation were carried out at substrate temperatures the range between 20ºC–415ºC.
PVA-Sansevieria trifasciata Fraction Films as Absorbers of Electromagnetic and Thermal Radiation on Smartphones Rahmani, Nabiila; Syahbirin, Gustini; Maddu, Akhiruddin; Sugita, Purwantiningsih; Ilmiawati, Auliya
Makara Journal of Science Vol. 27, No. 1
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Technological developments have prompted the production of highly advanced smartphones. However, various advanced features cause smartphones to heat up quickly and emit more electromagnetic radiation, which harms human health. Smartphone protection is needed to solve these issues. This study aims to create a film from the S. trifasciata plant based on polyvinyl alcohol (PVA) to reduce electromagnetic and thermal radiation on smartphones. S. trifasciata plants were macerated with acetone and partitioned with n-hexane, dichloromethane, ethyl acetate, and water. The films were made by mixing PVA with the four fractions. Among the four layers of film, the PVA + water and PVA + ethyl acetate fractions reduced electromagnetic radiation by 25.34% and 2.64%, respectively, and smartphone heat by 3.82 °C and 2.8 °C, respectively, the largest reductions. The results of an LC–MS/MS analysis show that the compounds thought to be contained in both fractions and play a major role in reducing electromagnetic and thermal radiation in smartphones are di-(2-ethylhexyl) phthalate, diisononyl phthalate, and two steroidal compounds, namely, stigmasterol and ergosterol peroxide.
Nutrients Ions Indices of Some Medicinal Flora of Cholistan Desert of Pakistan Yasin, Ghulam; Altaf, Adeela; Haq, Ikram ul; Nazeer, Samra; Sabir, Mubasharah
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

By knowing the nutritional status of a plant, one can better manage and use it for ethnobotanical purposes. Various nutrients are accumulated as osmotica in plants of stressful environments. The type and quantity of nutrients present in plants also determine the effectivity of medicine obtained from that plant. Hence, practical utilization of these plants as food or medicines needs to explore the exact nature and presence of the nutrient ions for discrimination of their toxic or medicinal nature. In the present study, some important nutrients in a number of xerophytic plants from Cholistan desert of Pakistan were quantified. Leave, stem and root specimens of seasonally available herbs, shrubs and trees were collected and analyzed for sodium, potassium and phosphorus contents. Each sample was replicated thrice. Obtained data were statistically analyzed and presented as Means ± standard deviations. Among the shrubs, maximum concentration of sodium was observed in leaves of Salsola imbricata (269.99 mg/g). The highest concentration of potassium was recorded in stem of Calotropis procera (67.78 mg/g) while maximum phosphorus was found in stem of Pseuda fruticosa (7.051 mg/g). Among the herbs, maximum sodium was found in stem of Orobanche aegyptiaca (234.95 mg/g), maximum potassium in leaves of O. aegyptiaca (270.71 mg.g) and the maximum phosphorus in root of Citrullus colocynthis (9.34 mg/g). For trees, maximum concentration of sodium, potassium and phosphorus were recorded in leaves of Tamarix aphylla (305.40 mg/g), stem of Capparis decidua (132.6 mg/g) and stem of Acacia nilotica (5.90 mg/g) respectively.
Application of Photoacoustic Imaging for Pneumonia Detection Maqfiroh, Caesarany; Widyaningrum, Rini; Anas, Ahmad Mujtahid; Mitrayana, Mitrayana
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

We used photoacoustic imaging (PAI) to visualize and compare acoustic intensity levels in pneumonia-affected and healthy chicken lungs. After histological confirmation of pneumonia, the samples were scanned and subjected to a 532-nm diode laser in a photoacoustic imaging system. The acoustic intensity level of pneumonia-affected tissue was examined and compared with that of healthy lung samples. The optimum laser frequency and duty cycle for imaging the samples were 17 kHz and 30%, respectively. The acoustic intensity levels of pneumonia-affected tissue and healthy lungs were −82.5 ± 1.8 dB and −79.9 ± 1.3 dB, respectively. We found that a simple PAI device consisting of a diode laser and condenser microphone could distinguish between pneumonia-affected and healthy lungs. Pneumonia-affected lungs produced less acoustic intensity than that healthy lungs, as supported by histological studies.
The Effect of Acidic pH on Growth Kinetics, Biomass Productivity, and Prima-ry Metabolite Contents of Euglena sp. Nurafifah, Istini; Hardianto, Muhammad Andhi; Erfianti, Tia; Amelia, Ria; Maghfiroh, Khusnul Qonita; Kurnianto, Dedy; Siswanti, Dwi Umi; Sadewo, Brilian Ryan; Putri, Renata Adaranyssa Egistha; Suyono, Eko Agus
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Euglena is a microalga with the potential to be an environmentally friendly renewable energy resource. The pH value is a crucial factor in micro-algal cultivation. Changes in pH affect the growth and development of microalgae, including the production of biomass and primary metabolites, such as proteins, carbohydrates, and lipids. In this study, Euglena sp. was grown on Cramer-Myers medium and subjected to various acidic conditions. This study aimed to determine the effect of pH on the growth kinetics, biomass, carbohydrate, lipid, and protein contents of Euglena sp. The Euglena sp. culture was optimized at various pH values of 2.5, 3.5, and 4.5. The results were analyzed by one-way analysis of variance at a 95% confidence level, followed by Duncan’s multiple range test. As results, Euglena sp. had the best growth rate, the greatest biomass, and the highest carbohydrate, protein, and lipid contents at pH 3.5 compared to the other pH conditions. The average biomass in the pH 3.5 treatment was 1.600 ± 0.229 g/L, and the carbohydrate, protein, and lipid contents were 5.983 ± 0.056 g/L, 0.196 ± 0.023 µg/mL, and 0.300 ± 0.020 g/L, respectively.
Molecular Simulation of B-Cell Epitope Mapping from Nipah Virus Attachment Protein to Construct Peptide-Based Vaccine Candidate: A Reverse Vaccinology Approach Kharisma, Viol Dhea; Dian, Farida Aryani; Burkov, Pavel; Scherbakov, Pavel; Derkho, Marina; Sepiashvili, Ekaterina; Sucipto, Teguh Hari; Parikesit, Arli Aditya; Murtadlo, Ahmad Affan Ali; Jakhmola, Vikash; Zainul, Rahadian
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

There are no specific drugs or vaccines for Nipah virus (NiV), which is a new Paramyxovirus that infects swine and humans. This study was conducted to investigate B-cell epitope mapping of the NiV attachment glycoprotein and to construct peptide-based vaccine candidates using the reverse vaccinology approach. To generate the linear B-cell epitope, the NiV isolates were extractad from GenBank, NCBI, using the IEDB web server; peptide modeling was conducted using PEP-FOLD3; docking was conducted using PatchDock and FireDock; and in silico cloning was designed using SnapGene. Various peptides were successfully identified from the NiV attachment glycoprotein based on B-cell epitope prediction, allergenicity prediction, similarity prediction, and toxicity prediction. An in silico cloning design of the pET plasmic was also developed. The peptide “RFENTTSDKGKIPSKVIKSYYGTMDIKKINEGLLD” (1G peptide) is predicted to be a potential candidate for the NiV vaccine as it has several good vaccine characteristics. It increases the immune response of B cells through activation, differentiation into plasma cells, the formation of memory cells, and it may increase IgM/IgG antibody titres for viral neutralization. However, the results of this study should be further verified through in vivo and in vitro analyses
Equilibrium and Kinetic Studies of Crude Oil Sorption on Unmodified and Modified Napier Grass Obi, Amalachukwu Ifeyinwa; Ajiwe, Vincent Ishmael; Okonkwo, Chinwe Priscilla
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Nowadays, natural organic adsorbents are widely used to clean up oil from spills owing to their effectiveness, affordability, and biodegradability. In this study, Napier grass, a widely available agricultural material, was used to remove crude oil from aqueous media. The Napier grass was modified via a mild acetylation process to improve its hydrophobicity. The modification increased the Brunauer–Emmett–Teller surface area of the grass from 180.07 to 271.13 m2/g. Fourier-transform infrared analysis revealed that the modification endowed the originally hydrophilic Napier grass with hydrophobicity. The oil sorption processes were based on monolayer physisorption and controlled by film diffusion. The oil sorption capacities of the unmodified and modified Napier grass under various adsorption conditions (adsorbent dose, initial crude oil concentration, and contact time) were significantly different. The equilibrium oil sorption capacities of the unmodified and modified grass were 7070 and 9057 mg/g, respectively, reflecting the improvement of oil sorption capacity by the modification process. These results indicate that the modification process significantly improved the crude oil adsorption ability of Napier grass. Thus, acetylated Napier grass is an effective, readily available oil sorbent with application potential for the cleanup of crude oil spills.
TiO2 Crystallization at Room Temperature and Preparation of Transparent Carbon Counter Electrode for Low-Cost Dye-Sensitized Solar Cells Syauqi, Muhammad Iqbal; Sanjaya, Afiten Rahmin; Madiabu, Mohammad Jihad; Khalil, Munawar; Gunlazuardi, Jarnuzi
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

We developed a low-cost dye-sensitized solar cell (DSSC) using TiO2 fabricated via rapid breakdown anodization (RBA) and ultrafast room-temperature crystallization (URTC). The prepared TiO2 was deposited on a self-made fluorine-doped tin oxide (FTO) conductive glass, and the FTO/TiO2 system was sensitized using curcumin dye. The DSSC was constructed by sandwiching the FTO/TiO2/curcumin electrode with an I−/I2 electrolyte and a transparent carbon counter electrode prepared using a liquid–liquid interface system. The characterization results showed that the TiO2 freshly prepared via URTC was transformed into an anatase crystalline phase, which exhibited a 3.10 eV band gap and a 10.08 nm average crystallite size, comparable to those of the TiO2 prepared via the conventional 450 °C annealing treatment (3.13 eV, 11.60 nm). The photocurrent activity of the URTC-prepared TiO2 under ultraviolet light (0.10 mA/cm2) was also comparable to that of the annealed TiO2 (0.12 mA/cm2). In addition, a transparent carbon electrode (FTO/Ct) was prepared successfully; it exhibited a ±58.26% transparency under visible light and comparable electrocatalytic activity to Pt-coated FTO. The DSSC based on FTO/TiO2-URTC/curcumin and FTO/Ct showed front and back illumination efficiencies of 0.47% and 0.26%, respectively. These results are only slightly lower than those of the conventional DSSC with FTO/annealed TiO2/curcumin//FTO/Pt, which exhibited front and back illumination efficiencies of 0.52% and 0.36%, respectively.