Claim Missing Document
Check
Articles

Found 37 Documents
Search

Molecular Surveillance of Dengue Virus Serotype Using Polymerase Chain Reaction in Surabaya 2013 Sucipto, Teguh Hari; Labiqah, Amaliah; Churrotin, Siti; Ahwanah, Nur; Mulyatno, Kris Cahyo; Soegijanto, Soegeng; Kotaki, Tomohiro; Kameoka, Masanori; Konishi, Eiji
Indonesian Journal of Tropical and Infectious Disease Vol 5, No 1 (2014)
Publisher : Institute of Topical Disease

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Dengue is one of the infectious diseases which is endemic in the tropical and sub-tropical country. The disease found in Indonesia Surabaya, 1968. The symptoms of Dengue virus infections are two kinds, first DF (Dengue Fever), second DHF (Dengue Hemorrhagic Fever). This infectious disease transmitted by Aedes aegypti mosquito. Mosquitoes breed in clean water areas. More than 100,000 cases of DF/DHF ccurred in Indonesia every year. The purpose of this study were to provide information and the spread of dengue virus types in Surabaya from January 2013 to September 2013. The nalysis technique used to determine the type of dengue virus nfectionwas used PCR (Polymerase Chain Reaction). The results obtained 69% DENV-1, 27% DENV-2 isolates, 4% isolates DENV-3, and 0% DENV-4 isolates.
SYNTHESIS OF METAL-ORGANIC (COMPLEXES) COMPOUNDS COPPER(II)-IMIDAZOLE FOR ANTIVIRAL HIV CANDIDATE Sucipto, Teguh Hari; Martak, Fahimah
Indonesian Journal of Tropical and Infectious Disease Vol 5, No 7 (2015)
Publisher : Institute of Topical Disease

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.20473/ijtid.v5i7.1204

Abstract

The human immunodeficiency virus (HIV) is viruses known as rotaviruses. Potential target for therapeutic is reverse transcriptase (RT), possesses an RNA-dependent DNA polymerase, DNA-dependent DNA polymerase and ribonuclease H fuctions. Imidazoles have high anti-HIV inhibitory activity, some derivates of imidazole reported drugs. 8-chloro-2,3-dihydroimidazole[1,2-b][1,4,2]benzodithiazine-5,5-dioxides and 9-chloro-2,3,4-trihydropyri-mido[1,2-b][1,4,2]benzodithi-azine-6,6-dioxides. This compounds succesfully identified anti-HIV activity. Copper is a bio-essential element and copper complexes have been extensively utilized in metal mediated DNA cleavage for the generation of activated oxygen species. It has been reported that teraaza macrocyclic copper coordination compounds have anti-HIV activities. Studies have shown that these macrocyclic complexes can react with DNA in different binding fashions and exhibit effective nuclease activities. Complex compounds are compounds in which there is an atom that acts as the central atom and trotter group of molecules that can be either neutral or charged ions. Application a metal-organic (complex) compounds, especially copper metal and derivates of imidazole. So, in this study can explore new anti-HIV candidate.
Toksisitas Senyawa Tembaga(II)Klorida Dihidrat Terhadap Sel Kanker Payudara T74D Secara in vitro Teguh Hari Sucipto; Harsasi Setyawati; Fahimah Martak
Qanun Medika - Jurnal Kedokteran FK UMSurabaya Vol 2, No 2 (2018)
Publisher : Universitas Muhammadiyah Surabaya

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (90.624 KB) | DOI: 10.30651/jqm.v2i2.1433

Abstract

Cancer is a transformation of normal cells in the body into malignancy due to the induction of carcinogens. Breast cancer is the second leading cause of death in Indonesia. The field of treatment with inorganic compounds has been widely developed and shows better anticancer activity than organic compounds. This research aims to know the toxicity level of copper value of 29.021 μg/ml. The value of IC 50 obtained <100 μg/ml so that the copperCancer is a transformation of normal cells in the body into malignancy due to the induction ofcarcinogens. Breast cancer is the second leading cause of death in Indonesia. The field oftreatment with inorganic compounds has been widely developed and shows better anticanceractivity than organic compounds. This research aims to know the toxicity level ofcoppervalue of 29.021 μg/ml. The value of IC50obtained<100 μg/ml so that the copper
Detection of Knockdown-Resistance Mutations (V1016G and F1534C) in Dengue Vector from Urban Park, Surabaya, Indonesia Shifa Fauziyah; Sri Subekti; Budi Utomo; Teguh Hari Sucipto; Hebert Adrianto; Aryati Aryati; Puspa Wardhani; Soegeng Soegijanto
Journal of Tropical Biodiversity and Biotechnology Vol 6, No 3 (2021): December
Publisher : Universitas Gadjah Mada

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.22146/jtbb.65357

Abstract

An urban park is potentially a source of vector-borne disease transmission due to it being a natural and artificial mosquito breeding habitats combined with people's continuous presence. Thus, this study aims to screen the occurrence of knockdown-resistance (kdr) mutant alleles (V1016G and F1534C) in mosquito populations collected from urban parks in Surabaya, Indonesia. Cross sectional study was conducted in July 2019. A total of 28 ovitraps were installed in seven urban parks, having four ovitraps installed in each park. In total, 1,662 eggs were collected, and only 187 emerged into adult mosquitoes, consisting of 97 Aedes (Stegomyia) aegypti and 90 Aedes (Stegomyia) albopictus. All-female adult mosquitoes (n=55) were tested using allele-specific polymerase chain reaction assay (AS-PCR) to detect voltage gated sodium channel (VGSC) gene mutations. This study found no mutations in Valine to Glysine mutation in point 1016 (V1016G) and Phenylalanine to Cysteine in point 1534 (F1534C) alleles in both two species. All of mosquito samples have wild type genotype of kdr alleles (V1016V and F1534F). Data were analysed using R Studio 1.4 Version by Genetics package. Results showed that the frequency of resistant alleles (G1016 and C1534) was zero, and the frequency of susceptible allele was 1 (V1016 and F1534). Insecticide bioassay could not be established due to the limited number of adult mosquitoes, so insecticide resistance status could not be determined. However, this study can be used as preliminary monitoring for the vector control program.
Analysis of N-nitrosodiprophylamines Carcinogenic Compound in Meat-Processing using Headspace-Single Drop Microextraction-Gas Chromatography-Flame Ionization Detector (HS-SDME-GC-FID) Teguh Hari Sucipto; Ganden Supriyanto; Yanuardi Raharjo
IPTEK Journal of Proceedings Series No 1 (2015): 1st International Seminar on Science and Technology (ISST) 2015
Publisher : Institut Teknologi Sepuluh Nopember

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (200.723 KB) | DOI: 10.12962/j23546026.y2015i1.1128

Abstract

Analysis of N-nitrosodiprophylamines carcinogenic compound in processed meat especially hamburger and kebab had occured by HS-SDME-GC-FID technique. The results were obtained determining the optimum pH was 4, the optimum stirring speed was 6 scale, and the temperature of extraction was 30 ºC. It was obtained in this study that the detection limit of 78 ppb, the percent recovery of 101,18%, precision between 0,089% to 0,566%, and the true enrichment factor was 3372,66 times. From the results of the study was concluded that HS-SDME-GC-FID technique can be used to analyze the carcinogenic compound N-nitrosodiprophylamines (NDPA) found in meat-processing (hamburger and kebab) by the concentration of each samples as follows, hamburger I of 0,27 ppm, hamburger II of 0,73 ppm, hamburger III of 1,39 ppm, and kebab I of 3,13 ppm
RNA Isolation of Dengue Virus Type 2 with Different Precipitation Solvents : Methanol, Chloroform, and 2-Isopropanol. Yovilianda Maulitiva Untoro; Teguh Hari Sucipto; Harsasi Setyawati; Siti Churrotin; Ilham Harlan Amarullah; Puspa Wardhani; Aryati Aryati; Shuhai Ueda; Soegeng Soegijanto
Jurnal Kimia Riset Vol. 3 No. 1 (2018): Juni
Publisher : Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (416.739 KB) | DOI: 10.20473/jkr.v3i1.7455

Abstract

Dengue virus distributed in tropical and subtropical regions in the world. DENV viruses are transmitted between humans primarily by Aedes aegypti and Aedes albopictus mosquitoes and are endemic in most areas in which the vectors occur. Four serotypes of dengue virus are DENV-1, DENV-2, DENV-3 and DENV-4. DENV-2 is comprised of six genotypes. Ethanol precipitation is a commonly used technique for concentrating and de-salting nucleic acids (DNA or RNA) preparations in aqueous solution. RNA isolation by combining Guanidinium thiocyanate and phenol reported has been reported. In this report, we investigated RNA isolation from DENV-2 using QIAamp Mini Kit with 2-Isopropanol, Methanol, Chloroform precipitation solvent. Electrophoregram showed DNA band as  the result of RNA isolation with methanol and 2-isopropanol are produced quite well. Dna band of the of RNA isolation with chloroform solvent has the lowest intensity than methanol and 2-isopropanol. This study showed that methanol and 2-isopropanol  can used as precipitation solvent for isolating RNA.
Precipitation Solvents for RNA Extraction of Dengue Virus Type 3: Dimethylformamide, Ethylenediamintetraacetic Acid, and Ultrapure H2O Rizqidhana Juliana Putri; Teguh Hari Sucipto; Harsasi Setyawati; Siti Churrotin; Ilham Harlan Amarullah; Puspa Wardhani; Aryati Aryati; Soegeng Soegijanto
Jurnal Kimia Riset Vol. 3 No. 2 (2018): Desember
Publisher : Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (477.838 KB) | DOI: 10.20473/jkr.v3i2.9353

Abstract

Dengue is a disease caused by a virus from the family Flaviviradae, carried by a female mosquito of Aedes aegypti species. Dengue fever is widespread in the tropic areas. It caused by rainfall, temperature and unplanned urbanization. According to the ministry of health , almost all provinces in Indonesia are endemic areas of dengue fever. In 2014, up to mid-December Dengue Hemorrhagic Fever (DHF) patients in 34 provinces in Indonesia are 71,668 people and 641. This figure is lower than the previous year, 2013 with 112,511 people and 871 deaths . This disease consists of four types of serotypes, namely DENV-1, DENV-2, DENV-3, and DENV-4. This disease can be identified using a variety of methods, one of the method is Reverse Transcription - Polymerase Chain Reaction (RT-PCR) method. This study aims to determine the ability of Dimethylformamide (DMF), Ethylenediamintetraacetic Acid (EDTA), and Ultrapure H2O as the substitute of  Ethanol for precipitation in RNA extraction process. The sample used in this research obtained from Surabaya. RNA extraction itself can be done by using a special kit for RNA extraction. In Reverse Transcription - Polymerase Chain Reaction method, first RNA is extracted and then transcribed back (Reverse Transcription) which then form cDNA that later will be amplified by using PCR method. In this study used specific primers for dengue virus type 3 (DENV-3). The results of this study show that DMF, EDTA, and Ultrapure H2O can be used as the substitute of Ethanol for precipitation on RNA extraction. The result is evidenced by the formation of viral DNA bands on gel electrophoresis results.
In Vitro Study: Effect of Cobalt(II) Chloride Against Dengue Virus Type 1 in Vero Cells Teguh Hari Sucipto; Yovilianda Maulitiva Untoro; Harsasi Setyawati; Anisa Maharani; Novia Faridatus Sholihah; Siti Churrotin; Ilham Harlan Amarullah; Soegeng Soegijanto
Indonesian Journal of Pharmacy Vol 30 No 4, 2019
Publisher : Faculty of Pharmacy Universitas Gadjah Mada, Yogyakarta, Skip Utara, 55281, Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.14499/indonesianjpharm30iss4pp316

Abstract

Dengue virus (DENV) serotypes DENV-1 to DENV-4 are enveloped viruses that belong to the genus Flavivirus of the Flaviviridae. Dengue vaccine or antiviral has not yet been clinically approved for humans, even though there have been great efforts toward this end. Antiviral activity against DENV is needed to develop to be an alternative drug for DENV virus. Cobalt(II) chloride have been used in the treatment and prevention of diseases of humans since ancient times. The aim of this study is to investigate the antiviral effects and Cytotoxicity of Cobalt(II) chloride. This compound was further investigated for its inhibitory effect on the replication of DENV-1 in Vero cells. Antiviral activity and Cytotoxicity measured by WST-1 assay. The IC50 value of the Cobalt(II) chloride for DENV-1 was 0.38 μg/ml. The cytotoxicity of Cobalt(II) chloride to Vero cell suggest that the CC50 value was 2.91 µg/ml The results of this study demonstrate the anti-dengue serotype 1 inhibitory activity of Cobalt(II) chloride was a high toxic compound.
HYPERTENSION SCREENING IN MULYOREJO PUBLIC HEALTH CENTER AT 2019: WHAT LESSONS LEARNED? Shifa Fauziyah; Budi Utomo; Teguh Hari Sucipto
The Indonesian Journal of Public Health Vol. 17 No. 1 (2022): THE INDONESIAN JOURNAL OF PUBLIC HEALTH
Publisher : Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (578.124 KB) | DOI: 10.20473/ijph.v17i1.2022.145-157

Abstract

Introduction: Hypertension is one of silent killer that become priority on health coverage era. Early detection and risk factors related must be conduct for effective prevention.  Methods: This research aimed to detected earlier hypertension case in adult and elderly people in Mulyorejo Public Health Center (PHC), Surabaya, Indonesia. Survey was conduct from 12th to 19th November with the target adult and elderly that were visited PHC. Structured questionnary were used as a screening instrument, and examination using digital tensimeter were used as gold standard. Family history, smoking, physical activity, vegetable consumption, and fruit consumption were recorded as independent variable. Data were analyzed using chi-square test. Accidental sampling and  total 0f 100 participants were joined this research, and 10% of them classified as hypertension based on examination using tensimeter, whereas 16% participants classified as hypertension based on structured questionnaire. Result: Validity was counted, and sensitivity showed 70%, spesifity was 87.78%, positive predictive value was 38.8%, negative predictive value was 96.34%. There’s no significant relationship between the independent variables family history  (p=0.48 ; OR=1.64 ; 95% CI= 0.42<OR<6.29), smoking (p=0.21 ; OR=2.96 ; 95% CI= 0.52<OR<16.7), physical activity (p=0.46 ; OR=1.71 ; 95% CI= 0.4<OR<7.29), vegetable consumption (p=0.94 ; OR=0.95 ; 95% CI= 0.25<OR<3.62), fruit consumption (p=0.89 ; OR=1.09 ; 95% CI= 0.29<OR<4.03), salt consumption (p=0.66; OR=1.33; 95% CI= 0.25<OR<6.98). Conclusion: There’s no relationship between independent variables with the hypertension during this study. In case, much effort from health worker to conduct medical check up massively would be needed, so that hypertension not become undetected. Keywords: family history, hypertension, screening, smoking, vegetable consumption
Molecular Simulation of B-Cell Epitope Mapping from Nipah Virus Attachment Protein to Construct Peptide-Based Vaccine Candidate: A Reverse Vaccinology Approach Kharisma, Viol Dhea; Dian, Farida Aryani; Burkov, Pavel; Scherbakov, Pavel; Derkho, Marina; Sepiashvili, Ekaterina; Sucipto, Teguh Hari; Parikesit, Arli Aditya; Murtadlo, Ahmad Affan Ali; Jakhmola, Vikash; Zainul, Rahadian
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

There are no specific drugs or vaccines for Nipah virus (NiV), which is a new Paramyxovirus that infects swine and humans. This study was conducted to investigate B-cell epitope mapping of the NiV attachment glycoprotein and to construct peptide-based vaccine candidates using the reverse vaccinology approach. To generate the linear B-cell epitope, the NiV isolates were extractad from GenBank, NCBI, using the IEDB web server; peptide modeling was conducted using PEP-FOLD3; docking was conducted using PatchDock and FireDock; and in silico cloning was designed using SnapGene. Various peptides were successfully identified from the NiV attachment glycoprotein based on B-cell epitope prediction, allergenicity prediction, similarity prediction, and toxicity prediction. An in silico cloning design of the pET plasmic was also developed. The peptide “RFENTTSDKGKIPSKVIKSYYGTMDIKKINEGLLD” (1G peptide) is predicted to be a potential candidate for the NiV vaccine as it has several good vaccine characteristics. It increases the immune response of B cells through activation, differentiation into plasma cells, the formation of memory cells, and it may increase IgM/IgG antibody titres for viral neutralization. However, the results of this study should be further verified through in vivo and in vitro analyses
Co-Authors , Sulistiawati Adi Sofyan Ansori, Muhammad Adiana Mutamsari Witaningrum Ahmad Rudi Setiawan Aini, Nur Sofiatul Aisyah, Nourmalasari Aksono HP., Eduardus Bimo Alelo, Richardo Reynaldi Sakka Amaliah Labiqah, Amaliah Anika Rahma Putri Anisa Maharani Aquaresta, Febriana Arli Aditya Parikesit Aryati Aryati Azizia Kanya Fathiarachman Bezhinar, Tatyana Budi Utomo Budi Utomo BUDI UTOMO Burkov, Pavel Candra Panji Asmoro, Candra Panji Chan Chow Khuen DAMAYANTI, MAMIK Derkho, Marina Dewi, Eryantika Cipta Dian, Farida Aryani Dwiyanti, Tasya Amalia Eiji Konishi, Eiji Eryantika Cipta Dewi Fachry Abda El Rahman Fadila, Syananda Zahra Fahimah Martak Farihah, Neni Isna Fathiarachman, Azizia Kanya Ganden Supriyanto Gudz, Petr Hapsari, Nafisah Nurul Hariyono Hariyono Hariyono Harsasi Setyawati Hebert Adrianto Herdiansyah, Mochammad Aqilah Hery Purnobasuki I Gede Widhiantara I Made Gde Sudyadnyana Sandhika I Wayan Rosiana Ihsan, Anaqi Syaddad Ilham Harlan Amarullah Jakhmola, Vikash Kautsar, Radinal Khairullah, Aswin Rafif Kharisma, Viol Dhea Khoirunnisa Suhandarini Khuen, Chan Chow Kinetasari, Theresia Janice Kris Cahyo Mulyatno, Kris Cahyo Kurniawan, Muhammad Ridho Hafid Kusala, Muhammad Khaliim Jati Kusala Leo Yosdimyati Romli Madaniyah, Safira Maharani, Anisa Mahfudhah, Dzikra Nasyaya Maksimiuk, Nikolai Masanori Kameoka, Masanori Mirwa Adiprahara Anggarani Munawir Sazali Murtadlo, Ahmad Affan Ali Nastiti, Helena Putri Naw, Sin War NI KADEK YUNITA SARI Ni Njoman Juliasih Novia Faridatus Sholihah Nugroho, Browi Nuha, Zakiyathun Nuniek Herdyastuti Nur Ahwanah, Nur Nur Fadhilah Nur Fadhilah Nur Syamsiatul Fajar, Nur Syamsiatul Nuryandari, Sufiandika Panjaitan, Novaria Sari Dewi Panjaitan, Novaria Sari Dewi Panjaitan Permatasari, Anak Agung Ayu Putri Permatasari, Anak Agung Ayu Putri Permatasari Prihartini Widiyanti PUJI LESTARI Puspa Wardhani Putri, Anika Rahma Putri, Deva Permata Putu Angga Wiradana Rahadian Zainul Rahmafitria, Fistara Lesti Ramadhani, Aisyah Hadi Rebezov, Maksim Rehman, Saifur Reny Mareta Sari, Reny Mareta Risanti Handayani Rizqidhana Juliana Putri Rollando, Rollando Safira Madaniyah Saiku Rokhim Saputri, Ratih Dewi Sari Edi Cahyaningrum Sari, Ni Kadek Yunita Sari Scherbakov, Pavel Sepiashvili, Ekaterina Setiawan, Ahmad Rudi Shifa Fauziyah Shifa Fauziyah Shifa Fauziyah Shifa Fauziyah Shifa Fauziyah Shuhai Ueda Sin War Naw Sin War Naw Siti Churrotin, Siti Soegeng Soegijanto Sri Pantja Madyawati Sri Pantja Madyawati, Sri Pantja Sri Subekti Sri Sumarsih Suhandarini, Khoirunnisa Sulistiawati Syananda Zahra Fadila Tan, Chin Xuan Tasya Amalia Dwiyanti Tomohiro Kotaki, Tomohiro TUKIRAN Tukiran Ueda, Shuhai Wardhani, Puspa Wiartini, Ni Wayan Ayu Wiartini Wibrianto, Aswandi Widati Fatmaningrum Widya, Alicia Margaretta Widyananda, Muhammad Hermawan Wijayanti, Alvia Rachma Win Darmanto Yanuardi Raharjo, Yanuardi Yovilianda Maulitiva Untoro Yuanita Rachmawati