Garuda - Garba Rujukan Digital

p-Index From 2021 - 2026

1.857

P-Index

This Author published in this journals

All Journal Jurnal Penelitian Saintek Inersia : Jurnal Teknik Sipil dan Arsitektur ILMU KELAUTAN: Indonesian Journal of Marine Sciences BULETIN OSEANOGRAFI MARINA Bioma : Berkala Ilmiah Biologi Prosiding Seminar Biologi Jurnal Akademika Biologi Teknosains: Media Informasi Sains dan Teknologi Journal of Biomedicine and Translational Research Prosiding KPSDA Tesa Arsitektur Journal of Tropical Biodiversity and Biotechnology JURNAL BIOLOGI INDONESIA BIOMA Majalah Ilmiah Biologi BIOSFERA: A Scientific Journal Biosaintifika: Journal of Biology & Biology Education Berkala Bioteknologi NICHE Journal of Tropical Biology Jurnal PROTEKSI (Proyeksi Teknik Sipil) Proceeding Biology Education Conference Berkala Penelitian Hayati Greensphere: Journal of Environmental Chemistry Makara Journal of Science JURNAL BIOLOGI PAPUA AGRIC

Wijanarka Wijanarka

Departement Of Biology, Faculty Of Science And Mathematics, The University Of Diponegoro, Semarang Indonesia

Author-ID : 417046

Agriculture, Biological Sciences & Forestry Biochemistry, Genetics & Molecular Biology Chemical Engineering, Chemistry & Bioengineering Chemistry Civil Engineering, Building, Construction & Architecture Computer Science & IT Control & Systems Engineering Decision Sciences, Operations Research & Management Earth & Planetary Sciences Economics, Econometrics & Finance Education Environmental Science Immunology & microbiology Materials Science & Nanotechnology Medicine & Pharmacology Physics Public Health Social Sciences

Published : 43 Documents Claim Missing Document

Claim Missing Document

Articles

1 2 3 4 5

In Silico Analysis Prediction of B-Cell Epitope as a Vaccine Candidate for SARS-CoV-2 B.1.617.2 (Delta) Variant Mauritz Nicolaas Wattimena; Wijanarka Wijanarka
Journal of Biomedicine and Translational Research Vol 8, No 1 (2022): April 2022
Publisher : Faculty of Medicine, Universitas Diponegoro

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.14710/jbtr.v1i1.13113

Background: The COVID-19 pandemic by SARS-CoV-2 has caused many losses. One way to prevent the spread of this virus is to get vaccinated. However, the latest SARS-CoV-2 variants, including variant B.1.617.2 (Delta) are doubtful to be inhibited by existing vaccines because of mutations. Therefore, we need a new vaccine candidate that is effective against this SARS-CoV-2 variant. Through an immunoinformatics approach with various software and analysis websites, vaccine candidates can be predicted in a short time.Objective: Identity, analyze, obtain, and confirm the selected B-cell epitope sequence that can be used as a vaccine candidate for the SARS-CoV-2 B.1.617.2 (Delta) variant.Methods: This research was conducted by isolating the amino acid peptide sequence in the SARS-CoV-2 B.1.617.2 (Delta) variant protein spike from the Protein Data Bank which is suspected to be an immunogenic epitope and can be used as a vaccine candidate. A Series of tests were carried out such as antigenicity, toxicity, allergenicity, and BLAST® protein to ensure that this vaccine candidate is safe for later application into the human body. The next stage is a conservation analysis to see its potential by comparing it with the SARS-CoV-2 Delta (B.1.617.2) variant spike protein sequence in Indonesia. The study ended by mapping amino acid peptides to the SARS-CoV-2 Delta (B.1.617.2) variant spike protein using the Biovia Discovery Studio Visualizer v21.1.0.20298 2020 software to ensure that the selected sequences were epitope.Results: From the five amino acid peptides that have been isolated, the FTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT epitope sequence has good results than the others. It is probable an antigen, non-toxic, non-allergen, and non-homolog to the human body protein.Conclusion: Based on this in silico study, it was found that the FTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT epitope sequence was the best to be used as a vaccine candidate of SARS-CoV-2 B.1.617.2 (Delta) variant.Keywords: SARS-CoV-2 B.1.617.2 (Delta) variant, B-cell epitope, vaccine, in silico, immunoinformatics.

RESPON PERTUMBUHAN Pichia manshurica DAN Rhodosporodium paludigenum PADA BERBAGAI MEDIA BASAL SEBAGAI PENENTU UNTUK PROSES ISOLASI PROTOPLAS Wijanarka Wijanarka; Endang Sutariningsih; Kumala Dewi; Ari Indrianto
Proceeding Biology Education Conference: Biology, Science, Enviromental, and Learning Vol 9, No 1 (2012): Prosiding Seminar Nasional IX Biologi
Publisher : Universitas Sebelas Maret

Show Abstract | Download Original | Original Source | Check in Google Scholar

ABSTRAK Pertumbuhan mikroorganisme biasanya ditunjukkan dengan adanya pertambahan jumlah sel atau masa sel yang sedang tumbuh. Pertumbuhan mikroorganisme dipengaruhi oleh faktor lingkungan hidupnya, salah satunya medium pertumbuhan. Medium tersebut sangat menentukan tingkat keberhasilan umur kultur dan profil fase pertumbuhan yang sangat penting pada saat isolasi protoplas. Tujuan penelitian ini adalah kinetika respon dan profil pertumbuhan Pichia manshurica dan Rhodosporodium paludigenum Pada Berbagai Media Basal. Metode yang digunakan dalam penelitian ini adalah eksperimental. Penelitian ini dilakukan pada bulan Januari-Februari 2011 di Laboratorium Mikrobiologi FMIPA UNDIP Semarang. Khamir Pichia manshurica dan Rhodosporodium paludigenum ditumbuhkan pada media basal MEB (M1), TEB (M2), ME (M3) dan YPD (M4) serta dilakukan pengamatan pertumbuhan setiap 6 jam selama 42 jam. Tahap berikutnya dilakukan studi analisis kinetika pertumbuhan khamir pada media basal yang berbeda. Hasil penelitian menunjukkan bahwa media YPD (M4) mempunyai kecepatan pertumbuhan (μ) tertinggi (0.2086 mg/jam) dan waktu generasi terpendek 3.3236 (menit) pada jam ke-18, sedangkan Rh. paludigenum mempunyai nilai μ sebesar 0.2751 (mg/jam) dan g sebesar 2.5197 (menit). Kesimpulan penelitian ini adalah media YPD (M4) dapat digunakan untuk pertumbuhan Pichia manshurica dan Rhodosporodium paludigenum serta dapat digunakan untuk media isolasi protoplas Kata Kunci: Pertumbuhan, media basal, P. manshurica dan R. paludigenum

ISOLATION OF Pichia manshurica PROTOPLAST FROM Dahlia sp. PLANT Wijanarka Wijanarka; Endang Sutariningsih Soetarto; Kumala Dewi; Ari Indrianto
JURNAL PENELITIAN BIOLOGI BERKALA PENELITIAN HAYATI Vol 18 No 2 (2013): June 2013
Publisher : The East Java Biological Society

Isolation of protoplasts is an important step in the fusion process. Protoplasts are cells that have eliminated the cell wall, but the cell membranes and organs can still function properly. Pichia manshurica is one of indogenous yeast that derived from Dahlia’s plants. The success rate protoplast isolation was determined by various factors, include the age of the culture and the used of lytic enzymes. The purpose of this research is to get the perfect age of yeast culture that is ready to be harvested and also to get the appropriate concentration of Glucanex lytic enzymes which used for protoplast isolation. The yeast of Pichia manshurica grown on YPD broth medium and growth observed in turbidimetry. Observation of the growth of yeasts performed every 6 hours for 42 hours. Glucanex lytic enzyme concentration used for the isolation of protoplasts is 0 mg / mL (L0 = control), 2 mg / mL (L2) and 4 mg / mL (L4). The results showed that the age of the culture is right and ready for harvest at the age of 24 hours and Glucanex lytic enzyme concentration of 4 mg / mL (L4) is able to produce the best of protoplasts at 7.2 x 1010.

Kemampuan memproduksi inulinase isolat khamir hasil isolasi dari Nira Siwalan (Borassus flabellifer L.) dengan variasi konsentrasi Siti Maisaroh; Wijanarka Wijanarka; Agung Suprihadi
NICHE Journal of Tropical Biology Vol. 3, No. 1, Year 2020
Publisher : Department of Biology, Faculty of Sciences and Mathematics, Universitas Diponegoro

Microbial inulinase is one of the most interesting enzymes, especially the ones produced by yeast. Yeast is commonly found in sugar-containing materials, such as Nira Siwalan (Borassus flabellifer L). Yeast uses simple sugar compounds in foods to obtain its energy. If the nira is stored, the fermentation begins to occur, carried by the natural microorganism of Nira Siwalan which causes sour taste as acetic acid is started to be formed. This condition is ideal for the microorganisms (such as yeast) to grow. This research aims to analyze the impact of the best calcium concentration towards the production of inulinase by indigenous yeast in Nira Siwalan (Borassus flabellifer L). The research was done in biotechnology laboratory, Biology Department, Faculty of Science and Mathematics, Diponegoro University. The activity of inulinase was determined using DNS method. The research was designed using Randomized Factorial Design with concentration of CaCl2 and incubation time as the factors. The CaCl2 concentration was differentiated into four categories: Ca0, Ca0.5, Ca1.0, and Ca1.5, while the incubation time was differentiated into 5 categories: T0, T4, T8, T12, T16, and T20. Each treatment is repeated three times. After that, the data obtained from the observation analyzed using ANOVA. The result shows that the addition of 0.5 mM CaCl2 with inulinase activity 0.555 IU/mL gives the best result.

Isolasi dan penapisan bakteri proteolitik endofit tanaman pepaya (Carica papaya L.) Lailatul Mubarokhah; Wijanarka Wijanarka; MG Isworo Rukmi
NICHE Journal of Tropical Biology Vol. 3, No. 2, Year 2020
Publisher : Department of Biology, Faculty of Sciences and Mathematics, Universitas Diponegoro

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.14710/niche.3.2.99-104

Isolasi khamir penghasil enzim inulinase dari buah kersen (Muntingia calabura) serta pengaruh mikronutrien mangan (Mn) pada produksi enzimnya Fitri Ulfana Risky; Wijanarka Wijanarka; Sri Pujiyanto
NICHE Journal of Tropical Biology Vol. 2, No. 2, Year 2019
Publisher : Department of Biology, Faculty of Sciences and Mathematics, Universitas Diponegoro

Pemanfaatan khamir inulinolitik indigenous ampas tebu (bagasse) sebagai penghasil biokatalis inulinase dalam produksi gula rendah kalori Moch Ali Utomo; Tia Erfianti; Dewi Ayu Maryati; Romario Dion; Pragati Wira Anggini; Wijanarka Wijanarka; Mochamad Hadi
NICHE Journal of Tropical Biology Vol. 4, No. 2, Year 2021
Publisher : Department of Biology, Faculty of Sciences and Mathematics, Universitas Diponegoro

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.14710/niche.4.2.56-63

Identifikasi dan Karakterisasi Isolat 23 Ducc Serta Kemampuannya dalam Memproduksi Enzim Inulinase Wijanarka Wijanarka; K Endang; Hermin Hermin
Majalah Ilmiah Biologi BIOSFERA: A Scientific Journal Vol 26, No 3 (2009)
Publisher : Fakultas Biologi | Universitas Jenderal Soedirman

Inulinase has a capacity to convert inulin into fructose hence it could be used in high fructose syrup production. Inulinase is not readily available in Indonesian market. This enzyme could be obtained from thermotolerant yeast found in Dahlia variabilis. Therefore this study was conducted to identify inulinolytic yeast in D. variabilis. The results showed that an inulinolytic yeast isolate 23 DUCC from D. variabilis tubers was found. The inulinolitic yeast produces inulinase (E.C.3.2.1.7). Based on the identification and determination, the isolate is known to be Kluyveromyces marxianus. The best optimation condition for this yeast was as follows: concentration of carbon source (inulin) was 0.75%, pH was 5.5 and time of fermentation was 53 hours. In such condition K. marxianus produced inulinase up to 0.6481 IU.

Produksi Pigmen Karotenoid oleh Khamir Phaffia rhodozyma yang Diperlakukan dengan Radiasi Sinar UV Sri Pujiyanto; Wijanarka Wijanarka; Endang Kusdiyantini; T. A. Lestari
Majalah Ilmiah Biologi BIOSFERA: A Scientific Journal Vol 23, No 2 (2006)
Publisher : Fakultas Biologi | Universitas Jenderal Soedirman

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.20884/1.mib.2006.23.2.146

Carotenoid pigment is an essential element in aquaculture, since it gives characteristic of color on shrimp and fish. Carotenoid pigments can be produced microbiologically using Paffia rhodozyma. Genetic improvement of the yeast, one of which can be accomplished by radiation mutation, will increase the production of carotenoid pigments. The aims of this study were to mutate P. rhodozyma using UV irradiation and to figure out pigment production by the mutant strains resulting from 30 minute-irradiation. Irradiated culture was incubated in dark condition and plated onto YMA media. Grown mutant colonies were collected in order to test for their pigment production. Pigment production was measured on the basis of extinction coefficient of 1%. The results showed that mutant strain encoded with MUV-1 produced the highest pigment at 179.96 mg/g dry weight cell, higher than the wild type (63.20 mg/g dry weight cell).

Optimasi Starter dalam Memproduksi Inulinase dan Identifikasi Khamir Inulinolitik BAN - 1 dari Umbi Dahlia (Dahlia variabilis Willd) Wijanarka Wijanarka; Endang Kusdiyantini; Hermin Hermin
Majalah Ilmiah Biologi BIOSFERA: A Scientific Journal Vol 27, No 3 (2010)
Publisher : Fakultas Biologi | Universitas Jenderal Soedirman

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.20884/1.mib.2010.27.3.205

Inulinolitic yeast isolated from dahlia tuber (Dahlia variabilis Willd) of Bandungan-Ambarawa, was found to produce inulinase enzyme (E.C.3.2.1.7). Under tested fermentation condition, BAN-1 inulinase isolate showed enzymatic activity in dose dependent manner to the starter concentration. A maximum enzymatic activity of 0.582 IU was produced by adding starter concentration 10%. Based on morphological, physiological and biochamichal evaluation it was indentified that the BAN-1 isolate is Pichia sp.

Co-Authors Agung Suprihadi Aini, Riris Nur Anggoro, Naufal Sebastian Anto Budiharjo Ari Indrianto Ari Indrianto Ari Indrianto Ari Indrianto Arina Tri Lunggani Asy'ari, Mukhammad Ayuningtyas, Annisa Nur Azzahra, Meilidya Falkhiya Chatarina Umbul Wahyuni Dewi Ayu Maryati Doktorasaintifika, Heradita Kaniaazzahra Dyah Wulandari Endang Kusdiyantini Endang Kusdiyantini Endang Kusdiyantini Endang Sutariningsih Endang Sutariningsih ENDANG SUTARININGSIH SOETARTO Endang Sutariningsih Soetarto Endang Sutariningsih Soetarto Fathika Fitrania Fauzaan, Muhammad Faishal Fitri Ulfana Risky Fransenda, Auxensius Rexer Ginting, Ledy HARTAJANIE, LAKSMI Herida, Azalia Puspa Hermin Hermin Hermin Pancasakti Kusumaningrum Ihdina Isfara Suteja Ika Anggraini Indra Bakti Sangalang Inggrit Amedia, Inggrit K Endang Kumala Dewi Kumala Dewi Kumala Dewi Kumala Dewi Lailatul Mubarokhah Laily Kurniawati Lindayani, Lindayani Lynda - Sutrisna Maria Sarah Fadillah Maulana, Anand Reyna Maulida Aglinia Mauritz Nicolaas Wattimena Mawarni, Risa Arum MG Isworo Rukmi Moch Ali Utomo Mochamad Hadi Muhammad Nur Muhammad Zainuri NANIK RAHMANI Nomeritae Nomeritae Noor Hamidah Nurhayati Nurhayati Pragati Wira Anggini Pratama Jujur Wibawa Putri S. Noor Rahmasari, Dianti Rahmasari, Dianti Rahmawati Dewi Rejeki Siti Ferniah Romario Dion Rudi Waluyo salamah salamah Sarjana Parman Sarsa A.N Shabrina, Jauhara Siti Maisaroh Siti Nur Jannah Sri Pujiyanto Sulis Setyowati, Sulis Susiana Purwantisari T. A. Lestari Tia Erfianti Tony Hadibarata, Tony Wahyuningsih, Candra YOPI YOPI Yusuf, Hadistiyani

Title

Found 43 Documents
Search

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Title Search

Found 43 Documents Search

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Abstract

Title

Found 43 Documents
Search