Claim Missing Document
Check
Articles

Found 35 Documents
Search

Molecular Simulation of B-Cell Epitope Mapping from Nipah Virus Attachment Protein to Construct Peptide-Based Vaccine Candidate: A Reverse Vaccinology Approach Kharisma, Viol Dhea; Dian, Farida Aryani; Burkov, Pavel; Scherbakov, Pavel; Derkho, Marina; Sepiashvili, Ekaterina; Sucipto, Teguh Hari; Parikesit, Arli Aditya; Murtadlo, Ahmad Affan Ali; Jakhmola, Vikash; Zainul, Rahadian
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

There are no specific drugs or vaccines for Nipah virus (NiV), which is a new Paramyxovirus that infects swine and humans. This study was conducted to investigate B-cell epitope mapping of the NiV attachment glycoprotein and to construct peptide-based vaccine candidates using the reverse vaccinology approach. To generate the linear B-cell epitope, the NiV isolates were extractad from GenBank, NCBI, using the IEDB web server; peptide modeling was conducted using PEP-FOLD3; docking was conducted using PatchDock and FireDock; and in silico cloning was designed using SnapGene. Various peptides were successfully identified from the NiV attachment glycoprotein based on B-cell epitope prediction, allergenicity prediction, similarity prediction, and toxicity prediction. An in silico cloning design of the pET plasmic was also developed. The peptide “RFENTTSDKGKIPSKVIKSYYGTMDIKKINEGLLD” (1G peptide) is predicted to be a potential candidate for the NiV vaccine as it has several good vaccine characteristics. It increases the immune response of B cells through activation, differentiation into plasma cells, the formation of memory cells, and it may increase IgM/IgG antibody titres for viral neutralization. However, the results of this study should be further verified through in vivo and in vitro analyses
Molecular Surveillance of Dengue Virus Serotype Using Polymerase Chain Reaction in Surabaya 2013 Sucipto, Teguh Hari; Labiqah, Amaliah; Churrotin, Siti; Ahwanah, Nur; Mulyatno, Kris Cahyo; Soegijanto, Soegeng; Kotaki, Tomohiro; Kameoka, Masanori; Konishi, Eiji
Indonesian Journal of Tropical and Infectious Disease Vol. 5 No. 1 (2014)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (250.228 KB) | DOI: 10.20473/ijtid.v5i1.207

Abstract

Dengue is one of the infectious diseases which is endemic in the tropical and sub-tropical country. The disease found in Indonesia Surabaya, 1968. The symptoms of Dengue virus infections are two kinds, first DF (Dengue Fever), second DHF (Dengue Hemorrhagic Fever). This infectious disease transmitted by Aedes aegypti mosquito. Mosquitoes breed in clean water areas. More than 100,000 cases of DF/DHF ccurred in Indonesia every year. The purpose of this study were to provide information and the spread of dengue virus types in Surabaya from January 2013 to September 2013. The nalysis technique used to determine the type of dengue virus nfectionwas used PCR (Polymerase Chain Reaction). The results obtained 69% DENV-1, 27% DENV-2 isolates, 4% isolates DENV-3, and 0% DENV-4 isolates.
SYNTHESIS OF METAL-ORGANIC (COMPLEXES) COMPOUNDS COPPER(II)-IMIDAZOLE FOR ANTIVIRAL HIV CANDIDATE Sucipto, Teguh Hari; Martak, Fahimah
Indonesian Journal of Tropical and Infectious Disease Vol. 6 No. 1 (2016)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (1015.057 KB) | DOI: 10.20473/ijtid.v6i1.1204

Abstract

The human immunodeficiency virus (HIV) is viruses known as rotaviruses. Potential target for therapeutic is reverse transcriptase (RT), possesses an RNA dependent DNA polymerase, DNA-dependent DNA polymerase and ribonuclease H fuctions. Imidazoles have high anti-HIV inhibitory activity, some derivates of imidazole reported drugs. 8-chloro-2,3-dihydroimidazole[1,2-b] [1,4,2]benzodithiazine-5,5-dioxides and 9-chloro-2,3,4-trihydropyri-mido[1,2-b][1,4,2]benzodithi-azine-6,6-dioxides. This compounds succesfully identified anti-HIV activity. Copper is a bio-essential element and copper complexes have been extensively utilized in metal mediated DNA cleavage for the generation of activated oxygen species. It has been reported that teraaza macrocyclic copper coordination compounds have anti-HIV activities. Studies have shown that these macrocyclic complexes can react with DNA in different binding fashions and exhibit effective nuclease activities. Complex compounds are compounds in which there is an atom that acts as the central atom and trotter group of molecules that can be either neutral or charged ions. Application a metal-organic (complex) compounds, especially copper metal and derivates of imidazole. So, in this study can explore new anti-HIV candidate.
BETLE LEAF ESSENTIAL OIL FOR HEMOPHILIAC PATIENTS AND ITS ANTIBACTERIAL EFFECTS ON MYCOBACTERIUM TUBERCULOSIS Sucipto, Teguh Hari; Aisyah, Nourmalasari; Lestari, Puji; Setyawati, Harsasi
Indonesian Journal of Tropical and Infectious Disease Vol. 6 No. 3 (2016)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (218.65 KB) | DOI: 10.20473/ijtid.v6i3.1387

Abstract

Betle leaf (Piper betle L.) is a medicinal plant. It contains essential oil and shows various biological activities, such as antibacterial, anticoagulant, etc. It is further reported to have low anticoagulant activities; thus, it is highly potential as a candidate for coagulant drug. Coagulant is used to prevent bleeding for patients with blood clotting disorders like hemophilia. In Indonesia, 1,236 people were reported with hemophilia. The standard parameters of anticoagulant activity are the freezing period and the compound concentrations. The purpose of this study was to determine the effect of betle leaf's essential oil on blood coagulation in patients with factor VIII and IX of blood plasma disorders. The isolation of essential oil is conducted through steam distillation method with two kinds of solvents, namely distilled water and n-hexane. The obtained n-hexane extract is then separated from the liquid-liquid extraction and rotary evaporator. Essential oil is diluted with citrate plasma solution. The test results of blood clots increase as the concentration of essential oils increase. The results are recorded as such: essential oils ½ times dilution of 99.67 seconds; ¼ times dilution of 127 seconds; 1/8 times dilution of 179 seconds; and 1/16 times dilution of 242.67 seconds. The test above proves that the piper betle extract possesses a coagulant activity. The ethanol extract contained in the piper betle could stimulate clotting in the blood cells. It is caused by the increase of blood plasma concentration which further escalate the plasma fluid into the blood cells. Based on this study, the activity of Mycobacterium tuberculosis can be obstructed by betle leaf in ½ times dilution. The extract significantly reduces acid which accelerates bacteria development.
ANTIVIRAL ACTIVITY OF COPPER(II)CHLORIDE DIHYDRATE AGAINST DENGUE VIRUS TYPE-2 IN VERO CELL Sucipto, Teguh Hari; Churrotin, Siti; Setyawati, Harsasi; Kotaki, Tomohiro; Martak, Fahimah; Soegijanto, Soegeng
Indonesian Journal of Tropical and Infectious Disease Vol. 6 No. 4 (2017)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (144.829 KB) | DOI: 10.20473/ijtid.v6i4.3806

Abstract

Infection of dengue virus (DENV) was number of globally significant emerging pathogen. Antiviral dengue therapies ar importantly needed to control emerging dengue. Dengue virus (DENV) is mosquito-borne arboviruses responsible for causing acute systemic diseases and grievous health conditions in humans. To date, there is no clinically approved dengue vaccine or antiviral for humans, even though there have been great efforts towards this end. Copper and copper compounds have more effective in inactivation viruses, likes an influenza virus and human immunodeficiency virus (HIV). Purpose in this project was investigated of Copper(II)chloride Dihydrate antiviral compound were further tested for inhibitory effect on the replication of DENV-2 in cell culture. DENV replication was measures by Enzyme linked Immunosorbent Assay (ELISA) with selectivity index value (SI) was determined as the ratio of cytotoxic concentration 50 (CC50) to inhibitory concentration 50 (IC50) for compound. The maximal inhibitory concentration (IC50) of Copper(II)chloride Dihydrate against dengue virus type-2 was 0.13 μg/ml. The cytotoxic concentration (CC50) of compound against Vero cell was 5.03 μg/ml. The SI values for Copper(II)chloride Dihydrate 38.69. Result of this study suggest that Copper(II)chloride Dihydrate demonstated significant anti-DENV-2 inhibitory activities and not toxic in the Vero cells. Copper mechanisms play an important role in the prevention of copper toxicity, exposure to excessive levels of copper can result in a number of adverse health effects, as a result increased reactive oxygen species and oxidative damage to lipid, DNA, and proteins have been observed in human cell culture models or clinical syndromes of severe copper deficiency and inhibition was attributed to released cupric ions which react with cysteine residues on the surface of the protease.
FEVER AS INDICATOR TO SECONDARY INFECTION IN DENGUE VIRAL INFECTION Soegijanto, Soegeng; Nuryandari, Sufiandika; Churrotin, Siti; Sucipto, Teguh Hari
Indonesian Journal of Tropical and Infectious Disease Vol. 7 No. 1 (2018)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (224.955 KB) | DOI: 10.20473/ijtid.v7i1.5640

Abstract

Dengue Virus Infections are distributed in tropical and sub-tropical regions and transmitted by the mosquitoes such as Aedes aegypti and Aedes albopictus. Dengue virus can cause dengue fever, dengue hemorrhagic fever and dengue shock syndrome or dengue and severe dengue classified by World Health Organization. Beside it concurrent infection virus salmonella had been found some cases who showed fever more than 7 days. Concurrent infection with two agents can result in an illness having overlapping symptoms creating a diagnostic dilemma for treating physician, such as dengue fever with typhoid fever. The aim of this research is detection of dengue virus and secondary infection with Salmonella typhi in patients suspected dengue virus infection. Detection of dengue virus and Salmonella typhi using immunochromatography test such as NS1, IgG/IgM for dengue virus infection, and IgM/IgG Salmonella and blood culture. The fifty children with dengue virus infection came to Soerya hospital and 17 cases suspected dengue virus infection, five cases showed a positive NS1 on the second day of fever and one case concurrent with clinical manifestation of convulsi on the third days of fever there were five cases only showed positive. It was showed in this study that on the fourth to six day of fever in dengue virus infection accompanied by antibody IgM & IgG dengue. There were 12 cases showed the clinical manifestation of concurrent dengue viral infection and Salmonella, all of them showed a mild clinical manifestation and did not show plasma leakage and shock. In this study we found the length of stay of concurrent Dengue Virus Infection and Salmonella infection is more than 10 days. These patients were also more likely to have co-existing haemodynamic disturbances and bacterial septicaemia which would have required treatment with inotropes and antibiotics. This idea is very important to make update dengue viral management to decrease mortality in outbreak try to gain new prevention method before the occurrence of outbreak.
INHIBITORY ACTIVITY OF COBALT(II)–MORIN COMPLEX AGAINST THE REPLICATION OF DENGUE VIRUS TYPE 2 Sucipto, Teguh Hari; Churrotin, Siti; Setyawati, Harsasi Setyawati; Mulyatno, Kris Cahyo; Amarullah, Ilham Harlan; Ueda, Shuhai; Kotaki, Tomohiro; Sumarsih, Sri; Wardhani, Puspa; Bendryman, Sri Subekti; Aryati, Aryati; Soegijanto, Soegeng; Kameoka, Masanori
Indonesian Journal of Tropical and Infectious Disease Vol. 6 No. 6 (2017)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (402.971 KB) | DOI: 10.20473/ijtid.v6i6.6126

Abstract

Dengue virus (DENV) is a significant pathogen emerging worldwide as a cause of infectious disease. Antidengue treatments are urgently required to control the emergence of dengue. DENV is a mosquito-borne disease responsible for acute systemic diseases and serious health conditions. DENVs were distributed in the tropical and sub-tropical areas and transmitted to humans by Aedes agypty and Aedes albopictus. Dengue vaccine or antiviral has not yet been clinically approved for humans, even though there have been great efforts toward this end. Antiviral activity against DENV is an important alternative for the characterization and development of drugs. Metal–organic compounds were reported to exhibit fungicidal, bactericidal, and antiviral activities its inhibitory activity was not significant, at high concentration it was more toxic to replicating cells than to stationary cell monolayers of Vero cells. The aim of this study is to investigate the antiviral effects of Cobalt(II)–Morin complex. This compound was further investigated for its inhibitory effect on the replication of DENV-2 in Vero cells. The replication of DENV was measured by enzyme-linked immunosorbent assay and the value of selectivity index (SI). SI was determined as the ratio of the 50% cytotoxic concentration (CC50) to the 50% inhibitory concentration (IC50). The IC50 value of the Cobalt(II)–Morin complex for DENV-2 was 3.08 µg/ml, and the CC50 value of the complex for Vero cells was 3.36 µg/ml; thus, the SI value was 1.09. The results of this study demonstrate the antidengue serotype 2 inhibitory activity of Cobalt(II)–Morin complex and its high toxicity in Vero cells. Further studies are not required before Co(II)–Morin can be applied in the treatment of DENV-2 infections.
RNA ISOLATION OF DENGUE VIRUS TYPE 1 WITH DIFFERENT PRECIPITATION SOLVENTS: DIMETHYL SULFOXIDE, ACETONE, AND ETHANOL 70% Maharani, Anisa; Sucipto, Teguh Hari; Setyawati, Harsasi; Churrotin, Siti; Amarullah, Ilham Harlan; Wardhani, Puspa; Aryati, Aryati; Ueda, Shuhai; Soegijanto, Soegeng
Indonesian Journal of Tropical and Infectious Disease Vol. 7 No. 3 (2018)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (585.948 KB) | DOI: 10.20473/ijtid.v7i3.6748

Abstract

Dengue Hemorrhagic Fever (DHF) is caused by dengue viruses that belong to Flaviviridae. The disease is known to be caused by 4 types of dengue viruses, namely DENV-1, DENV-2, DENV-3, and DENV-4 associated with antigenic. Dengue virus is a virus RNA that causes illness with clinical manifestations of Dengue Fever, Dengue Hemorrhagic Fever and Dengue Shock Syndrome. The aim of research was to determine the effectiveness of dimethyl sulfoxide, acetone, and ethanol 70% as precipitation solvent in the process of RNA isolation. The method used was Reverse Transcription - Polymerase Chain Reaction (RT-PCR) and Polymerase Chain Reaction (PCR) with specific primers for dengue virus type 1 (DENV-1). RNA isolation can be done easily using an RNA Isolation Kit. Use of RNA Isolation Kit results in a purer RNA isolate from contaminants and from RNA degradation. In generally the isolation is using cold ethanol / alcohol with concentration 90-95%. Ethanol / Alcohol does not dissolve RNA and light density of alcohol lighter than water makes RNA rise and hover on the surface. In RNA isolation solvent precipitation that used are acetone, ethanol 70%, and DMSO. In qualitative RNA measurements using agarose gel electrophoresis and was examined under the UV light-illuminator and quantitative RNA measurements using Nanodrop spectrophotometry with absorbance ratio at 260/280 and 260/230 showed a good result indicated by the appearance of the band on electrophoresis results in PCR. While the measurement quantitatively is showed that there was still protein contamination but the results are quite good because it does not much different from the ratio set in the reference. Acetone, ethanol 70%, and DMSO can be used as a substitute of 96% ethanol in the process of RNA isolation in DENV-1 virus and can also be applied to other dengue virus because the structure of the 4th antigen serotype is very similar one with the other and no effect.
ANTI-DENGUE TYPE 2 VIRUS ACTIVITIES OF ZINC (II) COMPLEX COMPOUNDS WITH 2-(2,4 -DIHYDROXYPHENYL)-3,5,7-TRIHYDROXYCROMEN-4-ONE LIGANDS IN VERO CELLS Sucipto, Teguh Hari; Setyawati, Harsasi; Churrotin, Siti; Amarullah, Ilham Harlan; Sumarsih, Sri; Wardhani, Puspa; Aryati, Aryati; Soegijanto, Soegeng
Indonesian Journal of Tropical and Infectious Disease Vol. 7 No. 5 (2019)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (777.006 KB) | DOI: 10.20473/ijtid.v7i5.10851

Abstract

Dengue virus (DENV) is a disease that is transmitted through Aedes aegypti and Aedes albopictus mosquitoes, and is spread in tropical and sub-tropical regions. Now, dengue or antiviral vaccines for humans do not yet exist, but there are great efforts to achieve this goal. Complex compounds are reported to fungicidal, bactericidal and antiviral activity. Antiviral activity against DENV is an important alternative to the characterization and development of drugs candidate. The purpose of this study was to study zinc(II) compounds with 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxycromen-4-one ligand on DENV-2 replication in Vero cells. Vero cell lines (African green monkey kidney) was used in this study, maintained and propagated in Minimum Essential Eagle Medium containing 10% fetal bovine serum at 37°C in 5% CO2. The activity of dengue virus was carried out by enzyme-immunosorbent assay (ELISA) method and CellTiter96® Non-Radioactive Proliferation. The value of activity inhibition (IC50) of complex compounds with variations of mol metal: ligand 1:2, 1:3, and 1:4 against dengue virus type 2 (DENV2) was 2.44 μg/ml, 2.75 μg/ml, respectively and 2.00 μg/ml, also the toxicity value (CC50) of complex compounds with variation mol metal: ligand 1:4 for Vero cells is 3.59 μg/ml. The results of this study were indicate that these properties have been shown to inhibit anti-dengue type 2 virus (DENV-2), but are also toxic in Vero cells. Including previous study about complex compound interaction with dengue virus type 2 activity, Zn(II) more reactive compound then Cu(II), and Co(II). The comparison with Cu(II) complex compound, it has been revealed that Co(II) and Zn(II) is more toxic, was found to be nontoxic to human erythrocyte cells even at a concentration of 500 μg/ml.
Effect of Zinc(II)-2,4,5-triphenyl-1H-imidazole Complex Against Replication DENV-2 in Vero Cell Sucipto, Teguh Hari; Wibrianto, Aswandi; Martak, Fahimah; Churrotin, Siti; Amarullah, Ilham Harlan; Setyawati, Harsasi; Wardhani, Puspa; Aryati, Aryati; Soegijanto, Soegeng
Indonesian Journal of Tropical and Infectious Disease Vol. 8 No. 3 (2020)
Publisher : Institute of Topical Disease Universitas Airlangga

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.20473/ijtid.v8i3.11776

Abstract

Dengue virus (DENV) is a significant pathogen emerging worldwide as a cause of infectious disease. DENVs are transmitted to humans through female mosquitoes from Aedes aegypti and Aedes albopictus species. Indonesia is one of the largest countries in the world in dengue endemic regions worldwide. Dengue fever was occurred for the first time as an outbreak in Surabaya and Jakarta in 1968. Many efforts have been made to prevent and treat DENV infections, and clinical trials of a number of vaccines are currently underway. Antiviral testing of DENV is an important alternative for drug characterization and development. Complex compounds are formed as a result of metal and organic complex reactions. Complex compounds can be used as an anti-inflammatory, antimicrobial antifungal, antibacterial, antivirus. The Zn2+ ion can be used as an antiviral candidate. The purpose of this project was investigated Zinc(II)-2,4,5-triphenyl-1H-imidazole antiviral compound to be further tested for inhibitory effect on the replication of DENV-2 in cell culture. DENV replication was measured by antiviral activity assay and cytotoxicity assay. The inhibitory activity of Zinc(II)-2,4,5-triphenyl-1H-imidazole complex compound was determined by Viral ToxGloTM Assay. The cytotoxicity of Zinc(II)-2,4,5-triphenyl-1H-imidazole complex compound was determined by CellTiter96® AQuoeus assay. The inhibitory concentration (IC50) of Zinc(II)-2,4,5-triphenyl- 1H-imidazole against dengue virus type-2 was 34.42 μg/ml. The cytotoxic concentration (CC50) of compound against Vero cell was <100 μg/ml. The results of this study demonstrate the antidengue serotype 2 inhibitory activity of investigated Zinc(II)-2,4,5-triphenyl-1H-imidazole complex and its high toxicity in Vero cells. Further studies are not required before investigated Zinc(II)-2,4,5-triphenylimidazole can be applied in the treatment of DENV-2 infections
Co-Authors Adi Sofyan Ansori, Muhammad Adiana Mutamsari Witaningrum Ahmad Rudi Setiawan Aini, Nur Sofiatul Aisyah, Nourmalasari Aksono HP., Eduardus Bimo Amaliah Labiqah, Amaliah Anika Rahma Putri Anisa Maharani Aquaresta, Febriana Arli Aditya Parikesit Aryati Aryati Azizia Kanya Fathiarachman Bezhinar, Tatyana Budi Utomo Budi Utomo BUDI UTOMO Burkov, Pavel Candra Panji Asmoro, Candra Panji Chan Chow Khuen DAMAYANTI, MAMIK Derkho, Marina Dian, Farida Aryani Eiji Konishi, Eiji Eryantika Cipta Dewi Fachry Abda El Rahman Fahimah Martak Farihah, Neni Isna Ganden Supriyanto Gudz, Petr Hapsari, Nafisah Nurul Hariyono Hariyono Hariyono Harsasi Setyawati Hebert Adrianto Herdiansyah, Mochammad Aqilah Hery Purnobasuki I Gede Widhiantara I Made Gde Sudyadnyana Sandhika I Wayan Rosiana Ihsan, Anaqi Syaddad Ilham Harlan Amarullah Jakhmola, Vikash Kautsar, Radinal Khairullah, Aswin Rafif Kharisma, Viol Dhea Khoirunnisa Suhandarini Kinetasari, Theresia Janice Kris Cahyo Mulyatno, Kris Cahyo Kurniawan, Muhammad Ridho Hafid Leo Yosdimyati Romli Maharani, Anisa Mahfudhah, Dzikra Nasyaya Maksimiuk, Nikolai Masanori Kameoka, Masanori Mirwa Adiprahara Anggarani Munawir Sazali Murtadlo, Ahmad Affan Ali Nastiti, Helena Putri Naw, Sin War NI KADEK YUNITA SARI Ni Njoman Juliasih Novia Faridatus Sholihah Nugroho, Browi Nuha, Zakiyathun Nuniek Herdyastuti Nur Ahwanah, Nur Nur Fadhilah Nur Syamsiatul Fajar, Nur Syamsiatul Nuryandari, Sufiandika Panjaitan, Novaria Sari Dewi Permatasari, Anak Agung Ayu Putri Permatasari, Anak Agung Ayu Putri Permatasari Prihartini Widiyanti PUJI LESTARI Puspa Wardhani Putri, Deva Permata Putu Angga Wiradana Rahadian Zainul Rahmafitria, Fistara Lesti Ramadhani, Aisyah Hadi Rebezov, Maksim Rehman, Saifur Reny Mareta Sari, Reny Mareta Risanti Handayani Rizqidhana Juliana Putri Rollando, Rollando Safira Madaniyah Saiku Rokhim Saputri, Ratih Dewi Sari Edi Cahyaningrum Scherbakov, Pavel Sepiashvili, Ekaterina Shifa Fauziyah Shifa Fauziyah Shifa Fauziyah Shifa Fauziyah Shifa Fauziyah Shuhai Ueda Sin War Naw Sin War Naw Siti Churrotin, Siti Soegeng Soegijanto Sri Pantja Madyawati Sri Pantja Madyawati, Sri Pantja Sri Subekti Sri Sumarsih Sulistiawati Syananda Zahra Fadila Tan, Chin Xuan Tasya Amalia Dwiyanti Tomohiro Kotaki, Tomohiro Tukiran Ueda, Shuhai Wardhani, Puspa Wibrianto, Aswandi Widati Fatmaningrum Widya, Alicia Margaretta Widyananda, Muhammad Hermawan Wijayanti, Alvia Rachma Yanuardi Raharjo, Yanuardi Yovilianda Maulitiva Untoro Yuanita Rachmawati