p-Index From 2021 - 2026
11.698
P-Index
This Author published in this journals
All Journal PROSIDING SEMINAR NASIONAL JURNAL ECONOMIA COPING (Community of Publishing in Nursing) Jurnal Ilmu keperawatan Jurnal Bidan Prada JURNAL PENGABDIAN KEPADA MASYARAKAT Bunda Edu-Midwifery Journal (BEMJ) JI-KES (Jurnal Ilmu Kesehatan) Jurnal Keperawatan Suaka Insan Jurnal Smart Keperawatan Viva Medika: Jurnal Kesehatan, Kebidanan dan Keperawatan Al-Asalmiya Nursing: Journal of Nursing Sciences Bhamada: Jurnal Ilmu dan Teknologi Kesehatan (E-Journal) NURSING UPDATE JURNAL ILMIAH ILMU KEPERAWATAN JURNAL PENELITIAN PERAWAT PROFESIONAL BIMIKI (Berkala Ilmiah Mahasiswa Ilmu Keperawatan Indonesia) BERNAS: Jurnal Pengabdian Kepada Masyarakat Jurnal Inovasi Penelitian Jurnal Ilmiah Pamenang (JIP) Pena Medika : Jurnal Kesehatan Jurnal Keperawatan Muhammadiyah Bengkulu Jurnal Ilmiah Wahana Pendidikan MAHESA : Malahayati Health Student Journal JINTAN : Jurnal Ilmu Keperawatan Shihatuna : Jurnal Pengabdian Kesehatan Masyarakat Mejuajua Journal of Language and Health Jurnal Ilmu Kesehatan Journal of Management Nursing Jurnal Pengabdian Masyarakat Kolaborasi Jurnal Pengabdian Masyarakat Journal of Innovation Research and Knowledge Borneo Community Health Sevice Journal Maternity and Neonatal : Jurnal Kebidanan Jurnal Riset Rumpun Ilmu Kedokteran (JURRIKE) Jurnal Rumpun Ilmu Kesehatan SEMINAR NASIONAL PENELITIAN DAN PENGABDIAN KEPADA MASYARAKAT Jurnal Keperawatan dan Kesehatan (JKK) Journal of Language and Pragmatics Studies Jurnal of Community Health Development (JCHD) Riset Informasi Kesehatan Jurnal Pengabdian Harapan Ibu (JPHI) Usada Nusantara: Jurnal Kesehatan Tradisional Jurnal Ilmu Kesehatan dan Gizi Promotor: Jurnal Mahasiswa Kesehatan Masyarakat SPIKESNAS Jurnal Anestesi: Jurnal Ilmu Kesehatan dan Kedokteran Java Nursing Journal Jurnal Riset Ilmiah Protein: Jurnal Ilmu Keperawatan dan Kebidanan Jurnal Ilmiah Kesehatan Mandira Cendikia Bhamada: Jurnal Ilmu dan Teknologi Kesehatan (E-Journal) JURNAL INSAN CENDEKIA JI-KES (Jurnal Ilmu Kesehatan)
Claim Missing Document
Check
Articles

Hubungan Antara Pengetahuan Dengan Sikap Tentang Cara Menyusui Pada Ibu Yang Memiliki Berat Bayi Lahir Rendah Sumarni, Tri; Lusmilasari, Lely; Nisman, Wenny Artanty
Jurnal Ilmu Keperawatan Vol 2, No 1 (2007)
Publisher : School of Nursing Faculty of Medicine Universitas Gadjah Mada

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Please refer to the file
HUBUNGAN ANTARA KEBIASAAAN OLAHRAGA DENGAN KEJADIAN NYERI HAID PRIMER PADA REMAJA Sugiharti, Rosi Kurnia; Sumarni, Tri
Bidan Prada: Jurnal Publikasi Kebidanan Akbid YLPP Purwokerto Vol 9, No 1 (2018): Jurnal Bidan Prada Edisi Juni 2018
Publisher : Bidan Prada: Jurnal Publikasi Kebidanan Akbid YLPP Purwokerto

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (176.415 KB)

Abstract

At the time of puberty is a lot of changes both psychological and biological. Changes in biological development, characterized by the biological youthfulness in the beginning of menstruation (menstruation). Physical disorders are very prominent in menstrual women is primere menstrual pain. Risk factors for primary menstrual pain vary in the first menstruation at a very early age, never gave birth to children, long periods of menstruation, nutritional status, smoking, exercise habits, stress. Based on preliminary study obtained from the interview on 25 female students of STIKES Harapan Bangsa Purwokerto midwifery study program showed that 45% said mild pain, 40% moderate pain, 15% severe pain. The purpose of this study was to determine the relationship between exercise habits with the incidence of primary menstrual pain at teens. The type of research used is analytic correlation with case study case control design. Samples using purposive sampling. Data were analyzed with frequency distribution and Chi Square. The results showed that there is a relationship between exercise habits with the incidence of primary menstrual pain in adolescents which is indicated by the value of p value 0.02.Keywords: exercise habits, primary menstrual pain events, adolescents
Persepsi Mahasiswa Ners Universitas Harapan Bangsa Tentang Pembimbing Klinik Tri Sumarni; Rosi Kurnia Sugiharti
Jurnal Smart Keperawatan Vol 6, No 1 (2019): Juni 2019
Publisher : Sekolah Tinggi Ilmu Kesehatan (STIKes) Karya Husada Semarang

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (118.495 KB) | DOI: 10.34310/jskp.v6i1.223

Abstract

LatarBelakang: Pembelajaranklinikdisepakatimenjadibagianpentingdaripendidikankeperawatan. Pembimbingklinik yang kompetenakanmemfasilitasimahasiswadalambelajar. Agar efektifmelakukanperantersebut, kompetensiprofesional, hubungan interpersonal, karakterpribadidankemampuanmengajardibutuhkanolehpembimbingklinik.Tujuan:Penelitianinibertujuanuntukmengetahuipersepsimahasiswanerstentangpembimbingklinik.Metode:Jenispenelitianiniadalah observasi kuantitatifdengandesaincross sectional denganmenggunakansampelsebanyak 81 mahasiswa ners.Pengambilan sampel dengan total sampling. Teknik pengumpulan data dengan menggunakan kuesioner. Instrumen penelitian menggunakan kuesioner Nursing Clinical Teacher Effectiveness Inventory (NCTEI). Analisisdatamenggunakanujistatistikt test  karena data terdistribusi normal (p > 0,2).Hasil: Pembimbing klinik yang efektif menurut persepsi mahasiswa yaitu yang mempunyai kompetensi profesional (mean 4,01), sementara yang tidak efektif terkait hubungan interpersonal (mean 2,78). Perbedaan terbesar antara pembimbing klinik yang efektif dan tidak efektif menurut persepsi mahasiswa yaitu di kemampuan mengajar (nilai t 17,88) dan kompetensi profesional (nilai t 17,74).Kesimpulan: Hasil penelitian menunjukkan bahwa pembimbing klinik yang efektif jika mempunyai kemampuan mengajar dan mempunyai kompetensi profesional, sehingga harapannya pembimbing klinik akan meningkatkan kemampuan mengajar dan kompetensi profesional untuk membantu mahasiswa mencapai tujuan pembelajaran klinik. Kata Kunci: Persepsi, PembimbingKlinik yang efektif, Pembimbingklinik yang tidakefektif
Peer Caring Behaviors dan Dukungan Sosial Terhadap Perilaku Caring Mahasiswa Sarjana Keperawatan Fakultas Kesehatan di Universitas Harapan Bangsa Tri Sumarni; Indri Heri Susanti; Agung Permana
Jurnal Smart Keperawatan Vol 8, No 1 (2021): JUNI 2021
Publisher : Sekolah Tinggi Ilmu Kesehatan (STIKes) Karya Husada Semarang

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.34310/jskp.v8i1.411

Abstract

Perilaku caring dipandang sebagai bagian penting dari keperawatan dan sebagai kompetensi yang diharapkan pada mahasiswa keperawatan. Kelompok teman sebaya sangat berguna dalam menyediakan lingkungan di mana mahasiswa keperawatan dapat belajar caring. Dukungan sosial juga penting untuk pengembangan profesional dan pribadi mahasiswa keperawatan. Tujuan dari penelitian ini untuk menganalisis hubungan peer caring behavior dan dukungan sosial dengan perilaku caring mahasiswa keperawatan. Penelitian ini merupakan penelitian deskriptif korelasional dengan pendekatan cross sectional. Sampel penelitian ini adalah mahasiswa program studi sarjana keperawatan sebanyak 250 mahasiswa yang terdiri dari semester 4, 6 dan 8 teknik pengambilan sampel menggunakan total sampling. Instrumen penelitian yang digunakan perilaku caring diadaptasi dari kuesioner Caring Behavior Inventory (CBI) dan kuesioner Peer Caring Behavior Scale serta Social Support Questionnaire. Hasil: Rata-rata peer caring behaviors 63,1, rata-rata dukungan sosial 16,5, rata-rata  perilaku caring 129,3, ada hubungan peer caring behavior dengan perilaku caring (r=0,269, p=0,015) dan hubungan dukungan sosial dengan perilaku caring (r=0,215, p=0,01). Kesimpulan: terdapat hubungan antara peer caring behavior dan dukungan sosial dengan perilaku caring.  Pendidik harus mendorong pelaksanaan perilaku caring diantara teman sebaya di kalangan mahasiswa sebagai sarana memfasilitasi hubungan mahasiswa dengan pasien dan keluarganya di masa yang akan datang. Pendidik juga mempertimbangkan peran potensial yang berkembang dari teknologi media sosial sebagai sumber dukungan sosial yang dapat diakses dan sebagai media pembelajaran dalam peningkatan perilaku caring. Kata Kunci: peer caring behaviors; dukungan sosial; perilaku caring  mahasiswa keperawatan  PEER CARING BEHAVIORS AND SOCIAL SUPPORT TOWARDS CARING BEHAVIOR OF BACHELOR NURSING STUDENTS AT FACULTY OF HEALTH HARAPAN BANGSA UNIVERSITY ABSTRACT Caring behavior is seen as an important part of nursing and as an expected competency in nursing students. Peer groups are very useful in providing an environment in which nursing students can learn caring. Social support is also important for the professional and personal development of nursing students. The purpose of this study was to analyze the relationship between peer caring behavior and social support towards nursing students' caring behavior. This research was a descriptive correlational study with a cross sectional approach. The sample of this study was 250 undergraduate nursing students consisting of semesters 4, 6 and 8. The sampling technique used total sampling. The research instrument used caring behavior was adapted from the Caring Behavior Inventory (CBI) questionnaire and the Peer Caring Behavior Scale questionnaire and the Social Support Questionnaire. The average of peer caring behavior was 63.1, the average social support was 16.5, the average caring behavior was 129.3, it is stated that there is a relationship between peer caring behavior and caring behavior (r = 0.269, p = 0.015) and the relationship between social support and caring behavior (r = 0.215, p = 0.01). There is a relationship between peer caring behavior and social support with caring behavior. Educators must encourage the implementation of caring behavior among students as a means of facilitating student relations with patients and their families in the future. Educators also consider the developing potential role of social media technology as an accessible source of social support and as a learning medium in enhancing caring behavior. Keywords: peer caring behavior; social support; caring behavior; nursing student’s caring behaviour
HUBUNGAN KECERDASAN EMOSIONAL DENGAN PERILAKU CARING PADA MAHASISWA KEPERAWATAN D3 STIKES HARAPAN BANGSA PURWOKERTO Tri Sumarni
Viva Medika Vol 9 No 2 (2016)
Publisher : Universitas Harapan Bangsa Purwokerto

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (309.994 KB) | DOI: 10.35960/vm.v9i2.131

Abstract

Concept of caring mentioned much in nursing practice, but rarely defined in the context of nursingeducation. The establishment and maintenance of caring behavior is important to set up the timeof learning in the lecture bench. Caring behavior of students in the learning process is importantbecause it can make the students become confident and caring can apply to their peers, as a basisfor caring for patients when it works. Formation of caring behavior is influenced by many factors,one of which emotional intelligence. The purpose of this study to analyze the relationship between emotional intelligence and caringbehavior D3 Nursing student.This research is a quantitative observational with cross sectional design with a sample of 182 D3Nursing student. Sampling with a total sampling. The research instrument was a questionnaire. Analysis to test the hypothesis between independent and dependent variables with Pearson productmoment.Emotional intelligence research results averaged 48.64 with SD 5.36; for caring behavior anaverage of 35.96 with 3.121 SD; there is a relationship between emotional intelligence and caringbehavior (p value 0.000). Keywords: Emotional Intelligence, Caring Behavior Nursing Student
HUBUNGAN REWARD DENGAN PERILAKU CARING PERAWAT PELAKSANA DI RUANG RAWAT INAP RSUD AJIBARANG Tri Sumarni; Yuris Tri Naili
Viva Medika Vol 10 No 1 (2017)
Publisher : Universitas Harapan Bangsa Purwokerto

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (82.857 KB) | DOI: 10.35960/vm.v10i1.142

Abstract

Nurses caring behavior is one of the essential components of the quality of hospital services. Organizational culture can influence the practice of caring behavior. Reward is one of components in the organization's culture. Patient satisfaction survey results indicated a lack of caring behavior in nurses in inpatient section Ajibarang hospital. This study aims to determine the relationship of reward with the behavior of caring nurses in inpatient hospitals Ajibarang. The study design was cross-sectional quantitative approach. Data were collected questionnaire to 41 nurses in May-June 2016 for inpatient section class III Ajibarang hospital. Data analysis included univariate, bivariate with chi square test. Results of univariate analysis showed that most nurses perceiving good reward (73.2%) and good caring behavior (58.5%). The bivariate analysis showed there is no associated between reward with nurses caring behavior (p = 0.303). Bidang Keperawatan Ajibarang Hospital expected caring behavior-related training and insert items into the standard procedur operational and caring nurse performance appraisal. Keywords: Reward, Caring Behavior
PENGARUH PEMBERIAN JUS Aloe vera TERHADA PENURUNAN KADAR GULA DARAH PADA PASIEN DIABETES MELLITUS TIPE II DI PUSKESMAS BUMIAYU KECAMATAN BUMIAYU KABUPATEN BREBES Tri Sumarni; Pramesti Dewi
Viva Medika Vol 5 No 2 (2012)
Publisher : Universitas Harapan Bangsa Purwokerto

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (199.49 KB) | DOI: 10.35960/vm.v5i2.231

Abstract

Diabetes mellitus (DM) or diabetes, including category degenerative diseases harmfulto humans at this time. One factor that may help lower blood sugar levels is to therapyAleovera juice (aloe vera), its content can lower blood sugar levels in addition to the need forinsulin / medication which contain many chemicals.This study aimed to determine the effectof aloe vera juice to decrease blood sugar levels in patients with Type II diabetes in BrebesDistrict Health Clinics Brits. This study used an experimental design with pre and post testapproach to design. Population / sample is non probability sampling with accidentalsampling method at the district health center. Brits as many as 25 people. Cheklist datacollection refers to blood sugar levels. Analysis of data using statistical test throughcomparative hypothesis is to test a population-shaped normal distribution comparison usingpaired T-test. Statistical test results on the respondents treated p value = 0.0002, There is asignificant relationship between the first measurement with the second measurement after agiven treatment administration of Aloe Vera juice to decrease blood sugar levels in patientswith diabetes mellitus type II. It was therefore concluded there is a significant differencebetween the levels of sugar in the first measurement with the second measurement. From thedata obtained the average sugar content 278.52 mg / dl, defiasi 51.23 mg / dl, and after giventhe aloe vera juice obtained an average sugar content 224.56 mg / dl highest sugar levels 314mg / dl and lowest 152 mg / dl with a standard deviation of 49.37 mg / dl. It is concluded thatadministration of Aloe Vera juice can lower blood glucose levels in diabetic patients. Keywords: Diabetes Mellitus Type II, Aloe Vera Juice, Blood Sugar Levels.
PENGARUH TERAPI SENAM KAKI TERHADAP PENURUNAN GLUKOSA DARAH PADA LANSIA DENGAN DIABETES MELLITUS DI POSYANDU LANSIA DESA LEDUG KECAMATAN KEMBARAN BANYUMAS Tri Sumarni; Danang Tri Yudhono
Viva Medika Vol 6 No 2 (2013)
Publisher : Universitas Harapan Bangsa Purwokerto

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (276.04 KB) | DOI: 10.35960/vm.v6i2.251

Abstract

The most health problems encountered in the elderly is a chronic disease that sometimesarise acutely and will suffer until death. Diabetes mellitus is a chronic disease that is oftenfound in elderly populations. Physical exercise is one of the four pillars of the implementation ofdiabetes mellitus because it can decrease glucose levels in the blood. One exercise thatrecommended in the elderly population is gymnastics feet. To know influence of gymnastics feet to degradation of blood glucose rate in elderly withdiabetes mellitus. This research conducted at health center of old age in Village Ledug DistrictKembaran. The type of this research is a quantitative with pre-experiment one group pretest andposttest design. Sampling using a total sampling technique with check-list form SOP and withthe glucometer brands Bionime GM 100 to measure 24 respondents. Analysis of the data usedthe Wilcoxon Signed Ranks Test. From these results there is a significant relationship between leg exercise therapy todecrease blood glucose in older adults with diabetes, where there the P value 0.014 <0.05.Most of the respondents experienced a decrease in blood glucose after doing gymnastics feettherapy. Based on the results of research are among the effect of gymnastic feet therapy todecrease blood glucose in older adult with diabetes mellitus, need for regular activitiesin exercise implementation in patients with diabetes mellitus. Keywords: Gymnastics Feet Therapy, Elderly and Diabetes Mellitus.
Kerja Shift Pagi, Sore Dan Malam Dengan Kelelahan Pada Perawat Wanita Di Ruang Rawat Inap RSUD Dr. R. Goeteng Taroenadibrata Purbalingga Tri Sumarni; Pramesti Dewi
Viva Medika Vol 7 No 2 (2014)
Publisher : Universitas Harapan Bangsa Purwokerto

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (227.233 KB) | DOI: 10.35960/vm.v7i2.273

Abstract

Shift work is work scheduled, either fixed or not fixed or outside normal hours of work. Each shift system has advantages and disadvantages. Shift systems can result in fatigue, health,social life and work performance. Woman nurses easy to feel less tired when working in shifts. Fatigue during work consist of physiological and psychological fatigue. Purpose of this study was to determine differences in the level of fatigue between morning,evening and night shift. The study was conducted in Inpatient Room dr. R. Goeteng TaroenadibrataRegional General Hospital. The study was analytical observation with cross sectional approach. Sampling waspurposive sampling and using a questionnaire as a data collection tool that was distributed to 90respondents. The statistical analysis used chi square test. The result of this study shows that therewere significant difference between the working fatigue on woman nurses, where p value 0.043. Key word : fatigue, shiftwork, woman nurse
PEMANFAATAN KARTU KONTROL SEBAGAI UPAYA PENURUNAN KADAR GULA DARAH PADA PENDERITA DIABETES MELLITUS Viny Lufiasari; Reni Dwi Setyaningsih; Tri Sumarni
Viva Medika Vol 8 No 1 (2015)
Publisher : Universitas Harapan Bangsa Purwokerto

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (283.57 KB) | DOI: 10.35960/vm.v8i1.277

Abstract

Diabetes mellitus is a metabolic disease as the result of an abnormal insulin secretion, insulinworking, or both of them. World Health Organization said that were 347 million people in theworldwide have diabetes mellitus. Diabetes mellitus is incurable, but the blood sugar rate can controlled by four pillars management of diabetes mellitus they are education, diet, physical exercise,and pharmacological therapy. The Control card of diabetes mellitus can used as a reminder anddocumentation, and to facilitate in monitoring diabetes mellitus management. The purpose of thisresearch is to know the effect of utilization control card to the decrease of blood sugar rate on patientswith diabetes mellitus in Prodia Health Gymnastic Community of Purwokerto. The researchmethodology was used a Pre Experimental Method with Pre-Test and Post-Test One Group Design.The research result shows that the majority of respondents were in the age group 60-74 years (64%),and the most are women (64%) than man (36%) with an average experience of diabetes mellitus for <5 years (50%). The data indicated that control card has an effect on decrease of blood sugar rate onpatients with diabetes mellitus (p=0,018). Keywords: Control Card, Blood Sugar Rate, Diabetes Mellitus
Co-Authors A Rizal Fadly Adiratna Sekar Siwi Adiratna Siwi Agun Pangestu Agung Permana Agustin, Triyana Aliefyansyah, Almayda Erris Aliya Permala Putri Amalia Diah Intan Pratiwi Amanda Sri Utari Amiarti, Winda Amin Susanto ANANDA, YORDAN DISKA Andika Parnomo Putra Andini, Amelia Anggoro Saputri, Desta Anton Suhendro Arif Imam Hidayat Ariko, Richard Arni Nur R Arni Nur Rahmawati Astrid, Anggun Tri Astuti, Yuria Dwi Atun Raudotul Ma&#039;rifah Ayunika, Viqtanesya Baehaqi Christine Dyah Danang Tri Yudhono Debi Ari Setiawan Desta Anggoro Saputri Dewandana, Rizal Rizky Dian Sukmawati, Ida Dwi ASTUTI Dwi Martyastuti, Ervita Dwi Novitasari Efendi, Muhamad Arif Eko Kurniawan, wasis Ernawati, Esti Farhani, Muhammad Fatih Fathyah, Vira Fatmawati, Putri Febi Septiani Fitriana Ika dewi H, Yuli Dwi Heri Susanti, Indri Hikmanti, Arlyana IASA, ARUM ANINDIKA Ika Dewi, Fitriana Indah Susanti Indri Indri Heri Susanti Indri Heri Susanti Indri Heri Susanti, Indri Heri Islamudin, Syarif Febrian Ita Apriliyani Junianto, Eko Wahyu Kaunang, Natasha Rachel Oeyanda Khofifah, Siti Konitasari, Rizky Rofiana Kristanto, Barlian Kurniawan, Wahyu Eko Kurniawan, Wasis Eko Laelly Rahmawati Lely Lusmilasari, Lely Lia Yuliana Made Suandika Madyo Maryoto Mamengko, Rullyana Puspitaningrum Maria Paulina Irma Susanti Mariah Ulfah Mariah Ulfah Martuti, Tri Martyastuti, Ervita Dwi Mesayu, Salma Fadzila Mila Dian Nur Milina Setianingsih Misto Misto Mudayana, Nico Murniati Murniati Mustofa, Adi Musyaffa, Almas Nanjar Widiastuti nasihhudin - - Nisa, Nailatun Nistiani, Desi Nuraeni, Novi Yulianti Nuriyah, Adinda Salma Pipit Alfia Marlinah Pramesti Dewi Prastiwi, Farah Wahyu Priyana, Dwi Indri Priyo Suparyadi Purnomo, Safik Setya Putri, Diannike Rahmawati, Anglia Rahmaya Nova Handayani Rakhmawati, Arni Nur Ratna Mujiatun Ray Hannif Fadillah Refa Teja Muti Reni Dwi Setyaningsih Reni Dwi Setyaningsih Reni Dwi Setyaningsih Rindhy Mei Adzelina Riska Yunia Burhanudin Riski Saputra Rochmat, Tri Rosi Kurnia Sugiharti Safik Setya Purnomo Salsa Dwi Ayuni Saputra, Yeli Saputri, Amaliawati Saputri, Desta Anggoro Sekar Siwi, Adiratna Shidqi Auliaa Yudha Siti Haniyah Suci Khasanah Sugiharti, Rosi Kurnia Suhendro, Anton Sukmanіngtyaꜱ, Wіlіꜱ Sunandar, Muhammad Aris Supriyanto, Azis Susanto, Amin Talitha, Yuliana Tammami, Zakiatu Tika Mutiyani Tophan Heri Wibowo Tri Martuti Trisula, Nabila Nasywa Nanda Triyastuti Triyastuti Tusa Fajri Isbaeti Tuti, Tuti Bhakti Umi ‘Aisyah Viny Lufiasari WASIS Wasis Eko Kurniawan Wenny Artanty Nisman, Wenny Artanty Widyanti, Sofia Wijayanti, Wili Indah Wilastri, Eti Wilis Sukmaningtyas Winahyu, Graytika Wirakhmi, Ikit Netra Yuda Muntaha Yudha, Shidqi Auliaa Yudono, Danang Tri Yunitasari, Dwi Teguh Yuris Tri Naili Zulfakhrizal, Zulfakhrizal