Claim Missing Document
Check
Articles

Pretest-Posttest Control Group Design of Discovery Learning-Based Content Learning System in The Materials of Atomic Structure and Periodic Elements System of Class X Vocational Schools To Improve High-Level Thinking Ability Sinta Rahmatika; Rahadian Zainul
EKSAKTA: Berkala Ilmiah Bidang MIPA Vol. 22 No. 4 (2021): Eksakta : Berkala Ilmiah Bidang MIPA (E-ISSN : 2549-7464)
Publisher : Faculty of Mathematics and Natural Sciences (FMIPA), Universitas Negeri Padang, Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.24036/eksakta/vol22-iss4/268

Abstract

A learning process in the form of electronics employing online learning and merging discovery learning learning models is known as a discovery learning-based content learning system. This study sought to determine the efficacy of a content learning method based on discovery learning for class X SMK students studying periodic systems and atomic structure material. This study employs the ADDIE development model, which is only applicable to the implementation stage and whose efficacy is being evaluated on a limited scale. Higher-order thinking abilities and student learning outcomes are impacted by the findings of measuring the efficacy of the discovery learning-based content learning system, as shown by an increase in the average score from the pretest to the posttest. The results of the t-test showed sig (2-tailed) 0.05, indicating that there is a significant difference between the learning outcomes and HOTS of students who use and don't use a content learning system based on discovery learning. This implies that content learning systems based on discovery learning on content related to atomic structure and the periodic system of elements are effectively designed to enhance student learning outcomes and higher-order thinking skills.
Estimating Zero Waste Index and Resident Waste Participation in Indonesian Middle City Muhammad Nizar; Rahadian Zainul; Syaifuddin Yana; Erdiwansyah Erdiwansyah; Irda Yunita
Jurnal Serambi Engineering Vol 7, No 2 (2022): April 2022
Publisher : Fakultas Teknik

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.32672/jse.v7i2.5905

Abstract

The municipal city has tried to provide the best solid waste services as possible, but the increase in these services does not necessarily increase public participation in managing waste. The objective of this research is to measure the performance of municipal solid waste management while Banda Aceh Indonesia. The research method uses the Zero Waste Index tool and community surveyed to get a more comprehensive picture of performance in overcoming waste problems. The results can be concluded that the Banda Aceh city government is still achieving a small Zero Waste Index which is 0.28. The majority of the population does not get waste socialization (76.07%), does not sort (75.21%), does not recycle waste (68.31%) and only 54.70% of the community collect used items for resale. The results of the two studies show that it is hard for Banda Aceh to achieve the goal of 30% waste reduction by 2025.
Molecular Simulation of B-Cell Epitope Mapping from Nipah Virus Attachment Protein to Construct Peptide-Based Vaccine Candidate: A Reverse Vaccinology Approach Kharisma, Viol Dhea; Dian, Farida Aryani; Burkov, Pavel; Scherbakov, Pavel; Derkho, Marina; Sepiashvili, Ekaterina; Sucipto, Teguh Hari; Parikesit, Arli Aditya; Murtadlo, Ahmad Affan Ali; Jakhmola, Vikash; Zainul, Rahadian
Makara Journal of Science Vol. 27, No. 2
Publisher : UI Scholars Hub

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

There are no specific drugs or vaccines for Nipah virus (NiV), which is a new Paramyxovirus that infects swine and humans. This study was conducted to investigate B-cell epitope mapping of the NiV attachment glycoprotein and to construct peptide-based vaccine candidates using the reverse vaccinology approach. To generate the linear B-cell epitope, the NiV isolates were extractad from GenBank, NCBI, using the IEDB web server; peptide modeling was conducted using PEP-FOLD3; docking was conducted using PatchDock and FireDock; and in silico cloning was designed using SnapGene. Various peptides were successfully identified from the NiV attachment glycoprotein based on B-cell epitope prediction, allergenicity prediction, similarity prediction, and toxicity prediction. An in silico cloning design of the pET plasmic was also developed. The peptide “RFENTTSDKGKIPSKVIKSYYGTMDIKKINEGLLD” (1G peptide) is predicted to be a potential candidate for the NiV vaccine as it has several good vaccine characteristics. It increases the immune response of B cells through activation, differentiation into plasma cells, the formation of memory cells, and it may increase IgM/IgG antibody titres for viral neutralization. However, the results of this study should be further verified through in vivo and in vitro analyses
Pengembangan Sistem Pembelajaran Flipped Classroom Berbasis Inkuiri Terbimbing Menggunakan Moodle Pada Materi Hidrokarbon Kelas XI SMA/MA Andre Juliano, Muhammad; Rahmatika Putri, Sinta; Zainul, Rahadian
Jurnal Pendidikan Tambusai Vol. 7 No. 2 (2023): Agustus 2023
Publisher : LPPM Universitas Pahlawan Tuanku Tambusai, Riau, Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.31004/jptam.v7i2.7048

Abstract

Dalam rangka memenuhi tuntutan revolusi industri 4.0, diperlukan pendekatan pembelajaran abad ke-21 yang telah dimodifikasi dari sistem tradisional ke sistem digital yang lebih canggih. Salah satu solusi pembelajaran yang dapat digunakan pada saat ini dan era revolusi industri 4.0 adalah Blended Learning. Penelitian ini bertujuan untuk mengevaluasi sistem pembelajaran flipped classroom berbasis inkuiri terbimbing pada materi Hidrokarbon untuk kelas XI SMA/MA. Penelitian ini menggunakan alat penelitian berupa angket validitas dan angket praktikalitas. Instrumen tersebut akan diberikan kepada dosen Jurusan Kimia FMIPA UNP dan guru kimia di SMA Negeri 05 Padang, serta peserta didik khususnya kelas XI IPA sesuai dengan proporsi masing-masing. Penelitian ini dilakukan sesuai dengan tahapan pengembangan model Plomp. Tahap awal adalah penelitian pendahuluan, sedangkan tahap berikutnya adalah fase pengembangan atau pembuatan prototype. Hasil penelitian menunjukkan bahwa sistem pembelajaran flipped classroom berbasis inkuiri terbimbing pada materi Hidrokarbon yang dikembangkan telah terbukti valid, dan tingkat praktikalitasnya termasuk dalam kategori sangat praktis.
Pengaruh Ukuran Partikel Serta Laju Alir Pada Penyerapan Ion Logam Cr6+ Menggunakan Kulit Langsat (Lansium domesticum) Andini, Namira Tri; Kurniawati, Desy; Zainul, Rahadian; Nasra, Edi
Periodic Vol 13, No 2 (2024): PERIODIC
Publisher : Departemen Kimia FMIPA UNP

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Chromium metal is a toxic and carcinogenic metal that needs to be addressed. Biosorption  can be used as one method to reduce lead metal level in waters. Biosorpsian is easy and simpler to use, more-ecomomial, and  environmentally friendly because it utilizes microorganisms and biomaterials. The purpose of this study was to determine the effect of particle size and flow rate on the absorption of Cr6+ metal ions using langsat peel as a biosorbent. In this study, Cr6+metal ions biosorption  was carried out using langsat peel with column method at a particle size variation of 106, 150, 250 and 425µm  and a flow rate variation of 1-4 ml/min. the results of this study were obtained optimum conditions at particle size 106 µm and flow rate 2 mL/min with optimum adsorbtion capacity of 5,02363 and 6,96203 mg/g.
Pemanfaatan Karbon dari Kulit Buah Kelor (Moringa oleifera) untuk Penjernihan Minyak Jelantah Novela, Riana; Zainul, Rahadian; Kurniawati, Desy; Pernadi, Niza Lian; Rahmi, Maulidia Arsyta; Istiqamah, Siti Sarah; Nizar, Umar Kalmar
Periodic Vol 13, No 1 (2024): PERIODIC
Publisher : Departemen Kimia FMIPA UNP

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.24036/periodic.v13i1.124150

Abstract

The high demand for cooking oil causes scarcity and increases the price of cooking oil in the market. Despite the scarcity, people still use it by heating it repeatedly. Cooking oil that has been used repeatedly is called used cooking oil which contains saturated fatty acids which will have a negative impact on health if reused. Therefore, this study aims to clarify used cooking oil by using carbon from moringa peels to improve the quality of used cooking oil. Moringa fruit peel contains cellulose and hemicellulose so that it can be used as a carbon source using the calcination method and tested for approximation such as tests for ash content, vapor content and bound carbon. Furthermore, carbon is applied in the clarification of used cooking oil by adsorption method. After the used cooking oil has been clarified, the properties of the used cooking oil are tested, such as density, flow rate, acid number and saponification number. The result of this research is that the resulting Moringa peel carbon at 250 - 350oC complies with the SNI 06-3730-2021 standard. The application of Moringa peel carbon in used cooking oil has been shown to reduce the density value to 0.886 g/mL, an acid number of 4.476 mg/KOH, and succeeded in increasing the value of the flow rate to 0.735 and the saponification number to 351.751 mg/KOH.
Application of CRISPR-Cas9 genome editing technology in various fields: A review Ansori, Arif NM.; Antonius, Yulanda; Susilo, Raden JK.; Hayaza, Suhaila; Kharisma, Viol D.; Parikesit, Arli A.; Zainul, Rahadian; Jakhmola, Vikash; Saklani, Taru; Rebezov, Maksim; Ullah, Md. Emdad; Maksimiuk, Nikolai; Derkho, Marina; Burkov, Pavel
Narra J Vol. 3 No. 2 (2023): August 2023
Publisher : Narra Sains Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.52225/narra.v3i2.184

Abstract

CRISPR-Cas9 has emerged as a revolutionary tool that enables precise and efficient modifications of the genetic material. This review provides a comprehensive overview of CRISPR-Cas9 technology and its applications in genome editing. We begin by describing the fundamental principles of CRISPR-Cas9 technology, explaining how the system utilizes a single guide RNA (sgRNA) to direct the Cas9 nuclease to specific DNA sequences in the genome, resulting in targeted double-stranded breaks. In this review, we provide in-depth explorations of CRISPR-Cas9 technology and its applications in agriculture, medicine, environmental sciences, fisheries, nanotechnology, bioinformatics, and biotechnology. We also highlight its potential, ongoing research, and the ethical considerations and controversies surrounding its use. This review might contribute to the understanding of CRISPR-Cas9 technology and its implications in various fields, paving the way for future developments and responsible applications of this transformative technology.
Detection of Pseudomonas aeruginosa pus wound isolate using a polymerase chain reaction targeting 16S rRNA and gyrB genes: A case from Indonesia Jamaluddin, Indra P.; Musa, Susan H.; Ethica, Stalis N.; Ansori, Arif NM.; Yosephi, Valensa; Atmaja, Peter Y.; Murtadlo, Ahmad AA.; Sahadewa, Sukma; Durry, Fara D.; Rebezov, Maksim; Derkho, Marina; Naw, Sin W.; Zainul, Rahadian; Rachmawati, Kadek
Narra J Vol. 4 No. 2 (2024): August 2024
Publisher : Narra Sains Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.52225/narra.v4i2.774

Abstract

Infectious wounds on the skin surface are easily colonized by bacteria from pyogenic group that manifest as inflammation, such as Pseudomonas aeruginosa. P. aeruginosa is a Gram-negative bacterium and an opportunistic pathogen known for causing invasive state in critically ill and immunocompromised patients. The aim of this study was to detect the 16S rRNA and gyrB genes in P. aeruginosa using polymerase chain reaction (PCR) method. The sample in this study was pus isolate from a 5-year-old boy with leg wounds. The bacteria were isolated on brain heart infusion broth (BHIB) media and identified with molecular identification. Sequencing and BLAST analysis were carried out to determine the similarity of gene identity by comparing sample sequence with other isolate sequences on the Gene Bank. The results of molecular identification showed amplification DNA band of around 934 base pairs (bp) for 16S rRNA and 225 bp for gyrB gene. The BLAST program demonstrated that the sample had 99.89% similarity with P. aeruginosa strain XC4 (accession code ON795960.1) for the 16S rRNA gene. Meanwhile, the gyrB gene exhibited 99.10% similarity with the P. aeruginosa strain PSA-1.2 (accession code KP172300.1).
Molecular interaction analysis of ferulic acid (4-hydroxy-3-methoxycinnamic acid) as main bioactive compound from palm oil waste against MCF-7 receptors: An in silico study Herdiansyah, Mochammad A.; Rizaldy, Rafli; Alifiansyah, Mochamad RT.; Fetty, Amelia JT.; Anggraini, Dhea; Agustina, Niken; Alfian, Fariz R.; Setianingsih, Primanita NM.; Elfianah, Verah; Aulia, Halimatus S.; Putra, Justitia ERP.; Ansori, Arif NM.; Kharisma, Viol D.; Jakhmola, Vikash; Purnobasuki, Hery; Pratiwi, Intan A.; Rebezov, Maksim; Shmeleva, Svetlana; Bonkalo, Tatyana; Kovalchuk, Dmitriy F.; Zainul, Rahadian
Narra J Vol. 4 No. 2 (2024): August 2024
Publisher : Narra Sains Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.52225/narra.v4i2.775

Abstract

Ferulic acid (4-hydroxy-3-methoxycinnamic acid) is a phytochemical compound that is commonly found in conjugated forms within mono-, di-, polysaccharides and other organic compounds in cell walls of grain, fruits, and vegetables. This compound is highly abundant in the palm oil waste. The aim of the study was to predict the anticancer activity of ferulic acid against the breast cancer cell lines (MCF-7) receptors through a computational analysis. MCF-7 receptors with PDB IDs of 1R5K, 2IOG, 4IV2, 4IW6, 5DUE, 5T92, and 5U2B were selected based on the SMILE similarity of the native ligand. Thereafter, the protein was prepared on Chimera 1.16 and docked with ferulic acid on Autodock Vina 1.2.5. The ligand-protein complex interaction was validated by computing the root mean square fluctuation (RMSF) and radius of gyration (Rg) through molecular dynamic simulation. In addition, an absorption, distribution, metabolism, excretion, and toxicity (ADMET) prediction was performed on ferulic acid using the pkCSM platform. The molecular docking revealed that the ferulic acid could interact with all receptors as indicated by the affinity energy <-5 kcal/mol. The compound had the most optimum interaction with receptor 2IOG (affinity energy=-6.96 kcal/mol), involving hydrophobic interaction (n=12) and polar hydrogen interaction (n=4). The molecular dynamic simulation revealed that the complex had an RMSF of 1.713 Å with a fluctuation of Rg value around 1.000 Å. The ADMET properties of ferulic acid suggested that the compound is an ideal drug candidate. In conclusion, this study suggested that ferulic acid, which can be isolated from palm oil waste, has the potential to interact with MCF-7 receptors.
Development of Voltammetry Analysis Method of Iron Metal Ions by Solid-State Membrane with Carbon Nanotube Suyanta, Suyanta; Sunarto, Sunarto; Padmaningrum, Regina Tutik; Karlinda, Karlinda; Isa, Illyas Md; Zainul, Rahadian; Fardiyah, Qonitah; Kurniawan, Fredy
Indonesian Journal of Chemistry Vol 24, No 3 (2024)
Publisher : Universitas Gadjah Mada

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.22146/ijc.81771

Abstract

This work developed a selectively modified electrode for measuring the Fe(II) ions in continuous integration using voltammetry techniques. The study assessed various aspects, such as linearity, scan rate, repeatability, and real sample analysis. The experiment is performed using differential pulse voltammetry (DPV). The findings of the study indicated that the voltammetry method exhibited a regression line of y = 36.507 ln(x) + 990.73, with a correlation value of 0.9627, with an optimum scan rate of 20 mV/s and good repeatability over five times measurement. On the other hand, when comparing the results using the UV-Vis spectrophotometric technique, the regression equation was found to be y = 0.20438x − 0.06987, with a correlation value of 0.99583. Notably, the voltammetry measurement outperformed the UV-Vis method since it allowed analysis of Fe(II) at concentrations up to 6.35 × 10−4 ppm (or 1.00 × 10−11 M), while the UV-vis measurement could only analyze up to 1.5 ppm (or 2.36 × 10−5 M). Consequently, the developed technique proves to be superior to the other methods for the analysis of Fe(II).
Co-Authors -, Bahrizal Adi Sofyan Ansori, Muhammad Admin Alif Afria Yolanda Agil Aditya Dinata Agustina, Niken Ahmad Fauzi Ahmed, Shafique Aini, Syamsi Alfian, Fariz R. Ali Amran Alif, Admin Alifiansyah, Mochamad Radika Tory Alifiansyah, Mochamad RT. Alizar Alyaa Farrah Dibha Amalia Putri Lubis Amaq Fadholly Ananda Putra Andini, Namira Tri Andre Juliano, Muhammad Andrean, Maifil Dwi Andromeda Andromeda Andromeda Anggraini, Dhea Anggriani Sirait, Nova Anjali, Ghoury Kharisma Anni Faridah Ansori, Arif NM. Antonius, Yulanda Ardi, Ahmad Maulana Arif Nur Muhammad Ansori Ariusni Ariusni Ariusni Elida Arli Aditya Parikesit Artha, Dwirani Puspa Asnil Asnil Asral, Suci Sukma Taruna Atmaja, Peter Y. Aulia, Halimatus S. B, Syamsul Amar Baharudin, Muhammad Daswar A. Bahrizal - Bambang Sudarmanta Bonkalo, Tatyana Budhi Oktavia Burkov, Pavel Butarbutar, Suryani Cika Dania Marca Deandra Savira Derkho, Marina Deski Beri Desy Kurniawati Devi Purnamasari Dhea Kharisma, Viol Dian, Farida Aryani Dinda Sahara Dings, Tim Godefridus Antonius Dori Yuvenda Durain Parmanoan Durry, Fara D. Dwi Finna Syolendra Edi Nasra Efran Ustia Rahmad Elfianah, Verah elida elida Elkhool, Tarek A. Ellizar ellizar Elvina Elvina Erdiwansyah Erdiwansyah Erwandri, Rianovriani Ethica, Stalis N. Ezi Anggraini Fadila Gusman Fajriah Azra Fauzan Yan Hawari Feriani, Feby Festiyed Fetty, Amelia JT. Fetty, Amelia Julia Tria Firmansyah Khairul Kamal Firmansyah, Muhammad Reffi Fitrah Mey Harmi Siregar Fitri, Ernarisa Fredy Kurniawan Goh, Khang Wen Guntur Bagus Pamungkas Hardeli Hardeli Hardeli Hary Sanjaya Hayaza, Suhaila Herdiansyah, Mochammad A. Herdiansyah, Mochammad Aqilah Hermansyah Aziz Hery Purnobasuki Hidayati, Shil ike sabaria Illyas Md. Isa Indah Permata Sari Indah Permata Sari Indang Dewata Irda Yunita Isa, Illyas Md Istiqamah, Siti Sarah Jakhmola, Vikash Jakmola, Vikash Jamaluddin, Indra P. Jamaludin Jamaludin Kadek Rachmawati Karlinda Karlinda Karlinda Karlinda Khairun Nisa Khairunnisa Khairunnisa Khalid, Ahmad Khudzairi Kharisma, Viol D. Kharisma, Viol Dhea Kolesnik, Evgeniy Kovalchuk, Dmitriy F. Krismadinata Krismadinata Lubis, Amalia Putri Lufri Lufri Ma'firah, Marla Maahury, Mirella Fonda Maksim Rebezov Maksimiuk, Nikolai Maria Kiseleva Marla Ma&#039;firah Muhammad Andre Juliano Muhammad Haris Effendi Hasibuan Muhammad Hermawan Widyananda Muhammad Nizar Muhammad Rizki Muhammad Rusdi Muhardi, - Muji Setiyo Mulia, Melindra Murtadlo, Ahmad AA. Murtadlo, Ahmad Affan Ali Musa, Susan H. Nadezhda Kenijz Nafika Nurullita Naw, Sin W. Nizar, Umar Kalmar Novela, Riana Novera Elsi Mudia Oki Muraza Oktarina, Cindy Parikesit, Arli A. Pera Meilita Pernadi, Niza Lian Pratiwi, Intan A. Priyono, Qiara Amelia Putri Putra, Abrar Suryadi Putra, Ananda Putra, Justitia ERP. Putra, Randi Purnama Putri Fatimah Putri, Intan Anika Qonitah Fardiyah Radeni Sukma Indra Dewi Rahma yulis lubis Rahma Zila Rahmatika Putri, Sinta Rahmi, Maulidia Arsyta Ramli Ramli Rasyadan Taufiq Probojati Ratna Sari Raudhatul Hanifa Rayandra Asyhar Rebezov, Maksim Regina Tutik Padmaningrum Remon Lapisa Revi Gina Gunawan Riga Rijas, Livia Putrima Riko Romas Prayuda Rilla Gina Gunawan Risky Setiawan Risty, Chika Mei Rizaldy, Rafli Rohadatul Nadya Maurani Roza Herlina Saklani, Taru Salsabila Tri Rahmi Sari Mustika Sari, Putri Manda Sari, Yollit Permata Scherbakov, Pavel Sepiashvili, Ekaterina Seprianto Setianingsih, Primanita NM. Shmeleva, Svetlana Siltiwi Mandar Sinta Rahmatika Sinta Rahmatika Putri Skunda Diliarosta Sofia Sri Rizki Putri Primandari Sri Ulfa Sentosa Sri Wahyu Wardani Sri Wahyuningsih Sri Whayu Wardani Suci Sukma Taruna Asral Sukma Sahadewa, Sukma Sunarto Sunarto Sunarto Sunarto Susilo, Raden JK. Suyanta Suyanta Svetlana Artyukhova Syaifuddin Yana Syamsi Aini Syifa Rahma Ayunda Syukri Syukri Arief Syukri Syukri Tacharina, Martia Rani Tafonao, Leni Anggraeni Tamara, Anindya Putri Teguh Hari Sucipto, Teguh Hari Tri Haryati Trihanto Setiadi Trisna Kumala Sari Turista, Dora Dayu Rahma Ullah, Md. Emdad Umar Kalmar Nizar Urmatul Uska Akbar Veneliza, Adila Vika Erlina Vikash Jakhmola Viol Dhea Kharisma Visca Alisia Arianti Visca Alisia Arianti Yanni, Fitri Yeni, Isra Yohandri Yosephi, Valensa Yulia Matrosova Yulia Mona Liza Yuni Aulia Putri Djasli Yusniasari, Putri Antika Yusrianti, Ike