p-Index From 2020 - 2025
13.88
P-Index
This Author published in this journals
All Journal PROSIDING SEMINAR NASIONAL HUMANIS JURNAL KIMIA SAINS DAN APLIKASI FORUM JURNAL ILMU SOSIAL Politika: Jurnal Ilmu Politik Nusa: Jurnal Ilmu Bahasa dan Sastra Jurnal Natur Indonesia Journal of Politic and Government Studies Jurnal Ilmu keperawatan Jurnal JSIKA Abdimas Intiqad: Jurnal Agama dan Pendidikan Islam Al-Adzka: Jurnal Ilmiah Pendidikan Guru Madrasah Ibtidaiyah PREDIKSI ISLAMICA: Jurnal Studi Keislaman Jurnal Arbitrer Heritage of Nusantara: International Journal of Religious Literature and Heritage Mimbar Sekolah Dasar An-Nisbah: Jurnal Ekonomi Syariah Madrasah: Jurnal Pendidikan dan Pembelajaran Dasar UNIVERSUM JPW (Jurnal Politik Walisongo) Pembaharuan Hukum JURNAL BIOLOGI INDONESIA INTEGER: Journal of Information Technology TIK ILMEU : Jurnal Ilmu Perpustakaan dan Informasi Jurnal Ilmu dan Riset Akuntansi MODELING: Jurnal Program Studi PGMI Gramatika: Jurnal Ilmiah Kebahasaan dan Kesastraan Al-Madrasah: Jurnal Ilmiah Pendidikan Madrasah Ibtidaiyah Wahana : Tridarma Perguruan Tinggi WAKTU: Jurnal Teknik UNIPA Prosiding Seminar Nasional Sains dan Teknologi Terapan community: Pengawas Dinamika Sosial BALANCE: Jurnal Akuntansi, Auditing dan Keuangan International Journal of Social Science and Business JIAFE (Jurnal Ilmiah Akuntansi Fakultas Ekonomi) EduReligia : Jurnal Pendidikan Agama Islam Unes Law Review International Journal of Islamic Business and Economics (IJIBEC) Jurnal Suara Keadilan Madrosatuna: Journal of Islamic Elementary School Journal of Islamic Monetary Economics and Finance AKURASI: Jurnal Riset Akuntansi dan Keuangan Jusikom: Jurnal Sistem Informasi Ilmu Komputer Jurnal Akuntansi dan Manajemen Pioneer: Journal of Language and Literature Jurnal Riset Mahasiswa Dakwah dan Komunikasi (JRMDK) Jurnal EK dan BI BERDAYA: Jurnal Pendidikan dan Pengabdian Kepada Masyarakat Indonesian Journal of Data and Science Al-Awqaf: Jurnal Wakaf dan Ekonomi Islam As Sibyan : Jurnal Kajian Kritis Pendidikan Islam dan Manajemen Pendidikan Dasar El-Qist : Journal of Islamic Economics and Business (JIEB) Insights in Public Health Journal Otonomi Awwaliyah Jurnal Ilmu Pengetahuan dan Teknologi (IPTEK) Jurnal Manajemen dan Organisasi Review (MANOR) JIHBIZ :Global Journal of Islamic Banking and Finance. Jurnal Riset Pendidikan Dasar (JRPD) STRATEGY : Jurnal Inovasi Strategi dan Model Pembelajaran Jurnal Media Informatika Al-Ibda: Jurnal Pendidikan Guru Madrasah Ibtidaiyah Juwara : Jurnal Wawasan dan Aksara Law Development Journal Jurnal Sistem Informasi Universitas Dinamika Jurnal Ekonomika dan Bisnis Islam Teknika Stigma : Jurnal Matematika dan Ilmu Pengetahuan Alam Unipa Jurnal Ilmiah Manajemen, Bisnis dan Kewirausahaan Bakti Budaya: Jurnal Pengabdian kepada Masyarakat Balanca : Jurnal Ekonomi dan Bisnis Islam Prosiding Seminar Nasional Teknik Elektro, Sistem Informasi, dan Teknik Informatika (SNESTIK) Jurnal Pengabdian Mandiri Jurnal Ilmu Hukum, Humaniora dan Politik (JIHHP) Jurnal Ekonomi, Bisnis dan Manajemen Journal of Accounting and Finance Management (JAFM) Journal of Law, Poliitic and Humanities International Journal of Law Society Services Jurnal Ilmiah Fokus Ekonomi, Manajemen, Bisnis & Akuntansi (EMBA) Jurnal Pengabdian Masyarakat Bhinneka ANWARUL: Jurnal Pendidikan dan Dakwah Jurnal Edukasi dan Pengabdian kepada Masyarakat (JEPKM) Heritage of Nusantara: International Journal of Religious Literature and Heritage Jurnal Pengabdian Masyarakat Ilmu Pendidikan Jurnal Pengabdian Masyarakat Bangsa Hortatori : Jurnal Pendidikan Bahasa dan Sastra Indonesia SOROT: Jurnal Pengabdian Kepada Masyarakat JEID JIM: Jurnal Ilmiah Mahasiswa Pendidikan Sejarah Jurnal Ilmiah Ekonomi dan Manajemen Bersatu: Jurnal Pendidikan Bhinneka Tunggal Ika Karunia: Jurnal Hasil Pengabdian Masyarakat Indonesia BERBAKTI: Jurnal Pengabdian Kepada Masyarakat Al-lubab : Jurnal Penelitian Pendidikan Dan Keagamaan Islam Jurnal Pengabdian Sosial Jurnal Pengabdian Masyarakat dan Riset Pendidikan MUALLIMUN : JURNAL KAJIAN PENDIDIKAN DAN KEGURUAN Journal of Natural Sciences and Learning Shibyan: Jurnal Pendidikan Guru Madrasah Ibtidaiyah Taxation and Public Finance Jurnal Medika: Medika Journal of Innovation and Teacher Professionalism An-Nisbah: Jurnal Ekonomi Syariah Jurnal ELTEK Jurnal Penelitian Multidisiplin Bangsa Journal of Accounting, Management and Islamic Economics Al-Lubab: Jurnal Penelitian Pendidikan dan Keagamaan Islam Jurnal Pemberdayaan Masyarakat dan Komunitas Humanities Horizon Journal International Conference on Islamic Studies Jurnal Indonesia Mengabdi Balance: Jurnal Akuntansi, Auditing, dan Keuangan JUITA Akurasi Research Journal on Teacher Professional Development
Claim Missing Document
Check
Articles

Gambaran Penerapan Diagnosis NANDA, NOC, dan NIC pada Klien Skizofrenia dengan Kasus Halusinasi Sulistyowati, Sulistyowati; Rahmat, Ibrahim; Warsini, Sri
Jurnal Ilmu Keperawatan Vol 2, No 2 (2007)
Publisher : School of Nursing Faculty of Medicine Universitas Gadjah Mada

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (1232.937 KB)

Abstract

Please refer to the file
Penyelesaian Sengketa antara Bank Sharî‘ah dengan Nasabah Bermasalah melalui Badan Arbitrase Sharî‘ah Nasional (BASYARNAS) menurut UU No. 30 tahun 1999 Sulistyowati, Sulistyowati
ISLAMICA: Jurnal Studi Keislaman Vol 9, No 1 (2014): Islamica
Publisher : Program Pascasarjana UIN Sunan Ampel Surabaya

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (479.463 KB) | DOI: 10.15642/islamica.2014.9.1.193-222

Abstract

This study deals with dispute settlement between Bank Syari’ah and its customers through the National Shari’ah Arbitration Board (BASYARNAS). It focuses to elaborate the procedures of dispute settlement between Bank Syari’ah and its customers of financing from the perspective of Islamic law according to Bill No. 30/1999 above law No. 30 year 1999. Based on procedures as mentioned in the bill with regard to arbitration and alternative dispute resolution, Basyarnas, in proofing and resolving cases, has fulfilled the procedures and satisfied the conflicting parties with justice, so there is no need to appeal and reconsideration. This means that Basyarnas has conducted dispute resolution according to the existing procedures. The dispute settlement has also been in accordance with the Qur’ân and other Islamic legal rules which consist of the principles of power and mandate applied by the arbitrator in deciding and resolving the dispute. The board—as an independent institution—has setttled the disputes on the basis of justice for all parties, rejected the act of bribery since the cost is measurable. In addition, Basyarnas also gives strong emphasis on the principle of equality, friendship, consistence and response-bility in resolving disputes.
Cultural Strategies of Abdi Dalem in The Global Era in Achieving Welfare Sulistyowati, Sulistyowati
Heritage of Nusantara: International Journal of Religious Literature and Heritage Vol 2, No 2 (2013)
Publisher : Center for Research and Development of Religious Literature and Heritage

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

The article aims at examining cultural strategies of Javanese community, particularly those of the abdi dalem (royal official), in achieving welfare. It is inevitable for the abdi dalem, who has existed for more than one century in Javanese community, to face the changes of era (global era). Javanese cultural values which are believed and accepted as the guidance in daily behaviour are opposed to the values in globalization that worship material as the highest value. The behaviour of abdi dalem as cultural actors holding thight to Javanese cultural values or Javanese logic (logika kejawen) in their evervdav lives will be understood in context to see their fiexibilties in responding to any changes accured around them. Through this understanding, the research is aimed to uncover the functions of cultural values as cultural identity and strategic function in promoting the sustainability of public support (abdi dalem) within the globalization challenges. Hopefully, the result of this research will be useful for the policy makers as well as the community to reveal the positive values of Javanese culture to adapt to the changing era. To obtain the objectives of the research, qualitative method is adopted. Methods of data collection used are participant observation and in-depth interviews. The informants selected in this study are the abdi dalem of Yogyakarta Palace. Through the interpretative approach of the symbols of abdi dalem behavior inexpressible that devotion to the king for ngalap berkah, simple lifestyles and the harmony principle is offered by abdi dalem to achieve welfare within the globalization challenges.
KEWIRAUSAHAAN PEMIJAHAN LELE SANGKURIANG DI KELURAHAN BUGEL KECAMATAN SIDOREJO KOTA SALATIGA Sulistyowati, Sulistyowati; Hutama, Tata Wedha
Jurnal Abdimas Vol 18, No 1 (2014)
Publisher : Lembaga Penelitian dan Pengabdian Masyarakat (LP2M), Universitas Negeri Semarang

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Mayoritas mata pencaharian penduduk Desa Bugel adalah Buruh Harian Lepas dan Karyawan Swasta baru kemudian diikuti oleh Wiraswasta (±22%). Banyaknya warga desa Bugel yang menjadi Buruh harian lepas kemungkinan karena banyak warga Desa Bugel yang hanya menempuh pendidikan sampai Sekolah Dasar (SD/Sederajat) sehingga mengakibatkan mereka kesulitan untuk mencari kerja. Dari permasalahan yang ada diatas maka perlu melakukan pelatihan dan pendampingan dengan baik dan benar sehingga hasilnya bisa digunakan untuk kebutuhan pasar dan menciptakan pekerjaan sendiri. Tujuan dan manfaat penyelenggaraan KKN vokasi adalah 1) Peserta pelatihan diharapkan mampu memproduksi benih yang optimal dan bisa mengerjakan dengan baik dan benar memijahkan lele sangkuriang sehingga dihasilkan benih yang sehat 2) Peserta pelatihan diharapkan bisa membuka usaha sendiri dan bisa menyerap tenaga kerja masyarakat sekitarnya 3) Menggali dan mengembangkan sumber daya lokal Kelurahan Bugel 4) Meningkatkan peran aktif Perguruan Tinggi, seperti Sekolah Tinggi Ilmu Pertanian Farming Semarang 5) Mewujudkan Kelurahan Bugel yang mandiri dan berbasis vokasi. Luaran kegiatan Yang Diharapkan: Peserta pelatihan bisa secara mandiri mengembangkan kewirausahaan pemijahan lele sangkuriang dan memenuhi kebutuhan benih lele di Kota Salatiga. Metode Pelaksanaan 1) Melalui proses pelatihan dan pendampingan di balai kelurahan, dan di Jl. Mutiara RT 02 RW 02 kelurahan Bugel untuk dibuatkan kolam percontohan yang dibantu oleh para Instruktur. Materi yang diberikan Pengenalan bahan, alat-alat dan kolam percontohan. Strategi-strateginya Memanfaatkan perangkat desa, Pokdakan yang berminat, untuk pelatihan pengembangan kewirausahaan pemijahan lele sangkuriang. Untuk mengetahui tingkat keuntungan, pengembalian investasi, maupun titik impas dilakukan analisis usaha. Dari perhitungan ternyata Usaha Pemijahan lele sangkuriang Skala Kecil secara finansial ini menguntungkan, dengan Nilai BEP harga sebesar Rp 45,75,- per ekor, BEP produksi sebesar 34.313 ekor maka usaha ini layak dipertahankan, maka usaha pemijahan ini dapat ditiru oleh semua anggota Pokdakan “Mina Kartika”.
Rancang Bangun Game Adventure Gyro Berbasis Android Menggunakan Model Rational Unified Process (RUP) Santoso, Edy; Sulistyowati, Sulistyowati; Rachman, Andy
INTEGER: Journal of Information Technology Vol 1, No 2 (2016): September 2016
Publisher : Fakultas Teknologi Informasi Institut Teknologi Adhi Tama Surabaya

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (738.181 KB) | DOI: 10.31284/j.integer.2016.v1i2.61

Abstract

People nowadays mostly use mobile device for their daily needs such as for playing game, Smartphone with android OS because they can play it anywhere. The game of Adventure Gyro was about the adventure of a child to save animal. The writer intended to make game as entertainment media because this contained message to save animal in our surroundings using rational unified process (RUP) model that consist of some phases such as; inception, elaboration, construction, transition. The early design of game was made in first phase, inception. The further design of game plot was conduction in elaboration phase. Then, game was made for sure in construction phase. The next was transition phase to test the game. After test conducted, the questionnaire on adventure gyro was given to 30 users who tried this game. From the result, it was found that the usability of this game was 85%, information quality was 79%, and interaction quality was 75%. Therefore, it can be concluded that this game is proper to be used.
Kecernaan dan Efisiensi Pakan pada Oposum Layang (Petaurus breviceps) di Penangkaran Farida, W. R.; Sulistyowati, Sulistyowati; Sigit, N.; Pratas, R. G.
JURNAL BIOLOGI INDONESIA Vol 3, No 4 (2002): JURNAL BIOLOGI INDONESIA
Publisher : Perhimpunan Biologi Indonesia

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.14203/jbi.v3i4.3390

Abstract

ABSTRACTDigestibility and Feed Emciency of Flying Squirrel (Petaurus breviceps) in Captivity.Two male flying squirrel (Petaurus breviceps) were used in this experiment to observe feedintake, digestibility and feed efficiency of them. The animals were given alternative diets incaptivity, namely passion fruit, sweet corn, banana, guava, papaya, coconut, sun flower bean,bread, and dogfood. The result showed that average intake of ash, crude protein, ether extract,crude fiber, nitrogen free extract, and gross energy were 2.4%, 2.3%, 9.3%, 6.0%, 69.9%, and4.0 kkallg respectively. The nutrient digestibility coefficient ash, crude protein, ether extract,crude fiber, and nitrogen free extract were 33.6%, 73.5%, 96.2%, 60.9%, and 95,5%respectively. Average body weight gain is 0.35 g/head/week and feed efficiency is 0,4%. Thepreferred feed is bread (58%), sweet corn (l2%), and coconut (1 1 %).Key words: Digestibility, consumption, feed efficiency, Petaurus breviceps
Prospek Pusat Informasi dan Perpustakaan dalam Perkembangan Information And Communication Technology (ICT) : Tinjauan Komprehensif Nilai Filosofi Ilmu Informasi dan Perpustakaan Iswanto, Rahmat; Sulistyowati, Sulistyowati
TIK ILMEU : Jurnal Ilmu Perpustakaan dan Informasi Vol 2, No 1 (2018)
Publisher : Perpustakaan STAIN Curup

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.29240/tik.v2i1.398

Abstract

This article is intended to see the future existence of the institution of information center and library as an institution that will continue to exist even if the information could be found by the community easily through the development of information and communication technology. In the present, people can access information through any approach in the worlds information network known as the internet. Moreover, if in the future the ability of people to choose the type of information needed better. Therefore it becomes a matter as how the prospect of information center and library in the development of Information and Communication Technology (ICT). By exploring the Information Science and Library as a fundamental branch of science, both seen from ontology, epistemology, and axiology is expected to know the basics of the prospects of information centers and libraries. The things that the information center and library should do will be seen through this assessment so that it will provide very useful inputs.
HUBUNGAN ANTARA PENGAWASAN DENGAN DISIPLIN KERJA ( STUDI KASUS DINAS KEHUTANAN PROVINSI KALIMANTAN TIMUR ) Sulistyowati, Sulistyowati
PREDIKSI Vol 2, No 2 (2016)
Publisher : PREDIKSI

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (47.185 KB) | DOI: 10.31293/pd.v2i2.2049

Abstract

SULISTIYOWATI. HubunganAntara Pengawasan Dengan Disiplin Kerja ( StudiKasusDinas Kehutanan Provinsi Kalimantan Timur ) dibawah bimbingan Ibu Dra.Hj. Nanik Pujiastutii, M.Si sebagai Pembimbing I dan bapak Suhardiman, S.Sos, M.Si sebagai Pembimbing II.Untukmengujikebenaranhipotesisapakahdapatditerimaatauditolak. Hasil penelitian menunjukkan bahwa Hal initerbuktidarihasilanalisis data dimanakorelasi r  yang diperolehsebesarantaravariabelPengawasan (X) denganDisiplinKerjaPegawai (Y) lebihbesarbiladibandingkandengan  rteoritisuntuk N = 40 padatingkatkepercayaan 95% yaitu : 0,671  0,321, Bahwahipotesis yang penuliskemukakandapatditerimakebenarannyakarenadidukungoleh data. Hal tersebutterbuktidimanasetelahdiadakanpengujianhipotesisdenganuji z, diperolehharga t lebihbesarbiladibandingkandengan t teoritis  (TabelHarga-hargaKritis t) padatingkatkepercayaan 95%  untuk N –1 (40 -1) = 39,  yaitu : 4,190 1,90, DenganadanyakorelasiantaraPengawasandenganDisiplinKerjaPegawai, makaterjawablahrumusanmasalahdalampenelitianini.Hasil yang diperolehadalah 4,190, makanilai z lebihbesardari 1,96 ( 4,190 1,96 ), sehinggapenulismenolak Ho ( Null hypothesis ) danmenerima H1 yang berartibahwamemangadakorelasi yang berarti. Ataudengan kata lainkorelasi antara x dan y adalahSignificance dan hipotesisditerimadenganintervalkepercayaansebesar 95 % ( 0,95 ).Apabila koefisiennya berkisar antara 0,600  sampai  dengan  0,800 maka terdapat korelasi yang cukup erat.dengandemikianhipotesiskeduaditerima. Kata kunci : Pengawasan, Disiplin 
PENGARUH GOOD CORPORATE GOVERNANCE TERHADAP KINERJA KEUANGAN PADA PERUSAHAAN PERBANKAN Sulistyowati, Sulistyowati; Fidiana, Fidiana
Jurnal Ilmu dan Riset Akuntansi (JIRA) Vol 6, No 1 (2017)
Publisher : STIESIA

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

The purpose of this research is to analyze the influence of good corporate governance to the financialperformance which consists of board of director, board of commissioner, independent commissioner, and auditcommittee to the financial performance of banking companies in Indonesia in 2012-2014 periods.The sampleshave been selected by using purposive sampling technique, based on the determined criteria 30 companies havebeen selected as samples. The result of this research shows that: (1) Board of directors has positive influencebecause the greater number of the board members can lead to more conflicts, but the number can provide analternative solution to a problem that is increasingly diverse in board members (2) Board of commissioners haspositive influence because when the member of commissioners that much , the control to the board of directors isgetting better (3) Independent commissioner doesn’t have influence because the existence of independentcommissioner in a company is formality only to fulfill the regulation(4) Audit committee doesn’t have influencebecause the duties of audit committee is to help the board of commissioners to control the reporting process offinancial statement by the management to improve the credibility of financial statements.Keywords: Good Corporate Governance, Board of Directors, Independent Commissioners, Audit Committee,CFROA.
ANALISIS TATO, NPM, DAN ROA TERHADAP PERTUMBUHAN LABA PADA PERUSAHAAN FOOD & BEVERAGE Sulistyowati, Sulistyowati; Suryono, Bambang
Jurnal Ilmu dan Riset Akuntansi (JIRA) Vol 6, No 4 (2017)
Publisher : STIESIA

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

This research is meant to test the influence of total assets turnover (TATO), net profit margin (NPM), andreturn on Assets (ROA) to the profit growth of go public companies. The research sample has been conductedby using purposive sampling. There are 50 financial statementswhich have met the criteria have been obtainedfrom 10 food & Beverages Companies in 2010-2014 periods.The data analysis has been done by usingmultiple regressions analysis and the independent variables i.e.: total assets turnover (TATO), net profitmargin (NPM), and return on assets (ROA). The dependent variable is profit growth (PL). The results of thisresearch have found that the variables i.e.: total asset turnover (TATO), net profit margin (NPM), return onAssets (ROA) have significant influence to the profit growth (PL). This finding is supported by the coefficientdetermination (R2) is 0.799 which shows that 79.9% of the profit growth can be explained by the variables i.e.:total assets turnover (TATO), net profit margin (NPM), and return on Assets (ROA). Meanwhile, theremaining is 20.1% has been influenced by other variables which are not included in the research models.
Co-Authors A Yachya, A Yachya Abdul Wahid Abdullah, Mu'in Adhi Purba, Ilyas Adikusuma, Rahmatullah Wirya Adityawan, Tofan Adjie Pambudi, Vito Pria Afifah, Hurotun Ahmad Taufiq Ahmad Yasin, Ahmad Ahwan Fanani Ainna Ningrul Ainul Arifin, Nuril Aji, Bimantoro Bayu Ajijah, Salsabilla Johan Akhdzulhijah, Akhdzulhijah Ala’uddin, M. Alimin Alimin, Alimin Amalia Anjani Arifiyanti Amalia, Listiati Amalina, Hana Amrullah Amrullah Anam, Choiril Andarista, Winna Shella Andi Sunyoto ANDI WIJAYA Andrianto, Okky Andy Rachman Anggraini, Milda Anwar Sodik, Anwar Anwar, Eva Naulia Aprilia, Elsa Rizki Ardiansyah, Ahmad Laskar Putra Arif Effendi, Arif Arsala, Taufiq Arywidyatama, Novantio Atin Supriatin, Atin Aulia Azizah Ayadilah, Sri Ayu, Ayu Azdy, Rezania Agramanist Azzahro, Syifa Badriyah, Leni Baitulloh, Sabit Bambang Cahyono Bambang Suryono, Bambang Bari, Muhammad Umar Al Basya, Maziya Mazza Budanis Dwi Meilani BUDI SETIAWAN Chusnah, Flourien Nurul Citra Y, Norita Daru Winarti, Daru Devvy Rusli Dewi Nadya Maharani Dori Jasrianto, Dori Edy Santoso Eka Yuliana Elly Natalina Emilia Emilia Endah Fauziningrum, Endah Esmayanti, Ratna Fachrizal Fachrizal, Fachrizal Fahmi, Mohammad Naufal Fahrudin, Hanif Fahrurrozi, Nanang Faisal, Mochamad Farel Yosua Sualang Farida, W. R. Farida, W. R. Fariz, Rifqi Fajrul Fathurrochman, R Mufid Fatuh Widoyo, Agus Ferdiansyah, M. Anandi Ferliyyana, Navilla Fidiana, Fidiana Fitri Handayani Fitriah Fitriah Fitriyah, Elok Giarno Giarno Gias, Muhammad Gusti Bintang Maharaja Hadma Yuliani Hamada Zein Hanifah, Nooratry Harmia, Citra Dewi Hartoyo*, Rudi Hasan, Ferdi Hendarko, Sriani Hendoyo, M Fajar Hidayat, Achmad Arly Hidayati, Rani Nurul Hidayatullah Hidayatullah Husin, Umar I Dewa Putu Wijana Ibrahim Rahmat Ikroiyani, Safira Indri Palindangan Insani, Putra Aulia Iskandar, Ali Ivany, Zulkarnain Jayaprawira, Acep R. Julianto Lemantara Kafi, Nur Holis Kertati Sumekar Ketherin, Basma Eno Khadafi, Shah Kharisma, Dhimas Dhesah Khusnul Khatimah Kinasih, Pertiwi Kristianto, Pascal Brilliandy Kristiyanto, Kristiyanto Kundori Kurniawati, Siti Ria Kusnul, Kusnul Lailla Hidayatul Amin Latifah, Yunita Shindi Leenawaty Limantara Lili Rusdiana, Lili Lilik Bintartik Lubis, Windi Nitasya Lusia Astrika M. Syabrina Maghfirotuna'imah, Mirda Mahama, Salmee Maharaja, Gusti Bintang Maharani, Dewi Nadya Mahmudah, Istiyati Manoppo, Hanifa Putri Mardiko, Ilham Agus Mardiyah, Shofiyah Abidatul Marjuki, Ahmad Mas Subagyo Eko Prasetyo, Mas Subagyo Eko Mastoah, Siti Maulida, Lutfia Maulida, Tasya Maulidati, Zuli Ma’ruf, Amir Meiny Suzery Minarto, Dian Mualimin Mualimin Mudah, Mah Muhammad Abrar Muhammad Hidayat Muharom, Faqihudin Muhima, Rani Rotul Mukti, Fajar Ali Mulatsih, Retno Mulyaningtyas, Ratna Dewi Munawwaroh, Siti Munif, Muhammad Muriawan, Adji Musrifah, Atikah Muthahari, Fairuz Abadi Nafi’ah, I. Nafi’ah, I. Najih, Ainun Nanang Fakhrur Rozi Nazli, Nazli Nessya, Nessya Ningsih, Indri Widia Nor Afni, Nor Afni Norhalizah, Norhalizah Norhayati Norhayati, Norhayati Norliana Norliana Nur Azizah, Ummi Nur Indah Rofiqoh, Siti Nurhadi, Slamet Nurhandini, Hilmi Nurmala Ahmar Nurul CH, Florine Nurul Hikmah Otong Rosadi P, Novilia Pakarbudi, Adib pamungkas, wardana galih Permatasari, Alisyah Pertiwi, Ratna Rahayu Pohan, Tassya Aulya Prakoso, Imam Prasetyo, Bagus Eko Prasetyo, Gilang Tegar Pratama Sandi Alala Pratiwi, Yesina Prihananda, Raafi Puji Rahayu Putra, Iqbal Rangga Putra, Muhammad Syahrur Ramdhani Putri Handayani Putri Kurniasih Putri, Rahmi Rizkiana Putri, Rezky Amelia R. G. PRATAS Rachman Arief, Rachman Raditya Sukmana Rahmad Rahmad Rahmah, Zakiyah Zulfa Rahman, Andi Asriyani Rahmat Iswanto, Rahmat Rahmawati, Marini Fitri ramadhan, Ichsan Ridha, Muhammad Paqih Ririn Tri Ratnasari Robertus, Benny Hermawan Roesjanto, Roesjanto Rofiqoh, Siti Nur Indah Rohmah, Annisa Rohmanita Duanaputri Roikhan Mochamad Aziz, Roikhan Mochamad Roni, Roni Rudi Setiawan Ruli Utami, Ruli Salsabila, Unik Hanifah Samekto, Agus Aji Sapuadi, Sapuadi Sari, Anita Maika Sari, Riska Imelda Sari, Widya Ratna Septikasari, Resti Setiawan, Permadi Setiawan, Permadi Setria Utama Rizal Sherly Jayanti Sholeh, Makherus Shulhi, Muhammad Ibda’u Sigit, N. Sigit, N. Siti Jubaidah, Siti Siti Rohimah Siwi, Galih Raga Solikhah Solikhah Sri Enggar Kencana Dewi Sri Hidayati Sri Mulyani Sri Sumantri, Andar Sri Warsini Subarkah Subarkah Suci, Nining Suhadi Suhadi Sukatin, Sukatin Sukresno Sukresno Sulistyowati, Riny Sumantri, Andar Sri Sumarna Sumarna Suparnyo Suparnyo Suprati, Diana Supriati, Diana Supriyanto Supriyanto Surahmat Surahmat, Surahmat susila, ika prima Syabrina, Muhammad Syahmidi Syahmidi, Syahmidi Syaidrawan, Syaidrawan Syamsuri Syar, Nur Inayah Syarifuddin, Akhmad Tan Amelia Tata Wedha Hutama, Tata Wedha Tuzaka, Eliya Ulfah, Lisa Ariska Ulfah, Lisa Ariska Utari Azim, Nur Santriani Uttungga, Resa Viki Bayu Mahendra Wahyu Widodo Wahyudi, Dimas Dwi Wibawa, Iskandar Wibowo, Laksono Wicaksono, Januar Cahyo Wijaya Putra, Mario Wulandari, Intan Kusuma Yuni Safitri yunus, Ahmad iqbal yunus, Ahmad iqbal Zafar, Eki Muhammad Zailani, Muhammad Qoolili Zaitun Qamariah, Zaitun